070701002EC6F1000041FD00000000000000000000001047CEFADA00000000000000080000001100000000000000000000000200000000.070701002EC78D000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000400000000bin070701002ECBF20000A1FF00000000000000000000000147CEFAF900000007000000080000001100000000000000000000000800000000bin/sedbusybox070701002ECC440000A1FF00000000000000000000000147CEFAED00000007000000080000001100000000000000000000000700000000bin/ipbusybox070701002ECD060000A1FF00000000000000000000000147CEFAF500000007000000080000001100000000000000000000000700000000bin/mvbusybox070701002ECBFD0000A1FF00000000000000000000000147CEFAFA00000007000000080000001100000000000000000000000A00000000bin/sleepbusybox070701002ECBD50000A1FF00000000000000000000000147CEFAE900000007000000080000001100000000000000000000000D00000000bin/hostnamebusybox070701002EC9D30000A1FF00000000000000000000000147CEFAE400000007000000080000001100000000000000000000000A00000000bin/egrepbusybox070701002EC8800000A1FF00000000000000000000000147CEFADB0000000E000000080000001100000000000000000000000C00000000bin/deluser/bin/tinylogin070701002EC93B0000A1FF00000000000000000000000147CEFADF00000007000000080000001100000000000000000000000A00000000bin/chmodbusybox070701002ECC260000A1FF00000000000000000000000147CEFAFD00000007000000080000001100000000000000000000000900000000bin/zcatbusybox070701002ECD710000A1FF00000000000000000000000147CEFAFB00000007000000080000001100000000000000000000000900000000bin/syncbusybox070701002EC8970000A1FF00000000000000000000000147CEFADB0000000E000000080000001100000000000000000000000C00000000bin/adduser/bin/tinylogin070701002ECD280000A1FF00000000000000000000000147CEFAF700000007000000080000001100000000000000000000000900000000bin/pingbusybox070701002EC9C00000A1FF00000000000000000000000147CEFAE300000007000000080000001100000000000000000000000700000000bin/dfbusybox070701002ECB7C0000A1FF00000000000000000000000147CEFAE800000007000000080000001100000000000000000000000900000000bin/grepbusybox070701002ECD260000A1FF00000000000000000000000147CEFAF700000007000000080000001100000000000000000000000A00000000bin/ping6busybox070701002EC8980000A1FF00000000000000000000000147CEFADB0000000E000000080000001100000000000000000000000D00000000bin/delgroup/bin/tinylogin070701002ECCD20000A1FF00000000000000000000000147CEFAF400000007000000080000001100000000000000000000000A00000000bin/mountbusybox070701002ECD300000A1FF00000000000000000000000147CEFAF800000007000000080000001100000000000000000000000800000000bin/pwdbusybox070701002ECDCF0000A1FF00000000000000000000000147CEFAFC00000007000000080000001100000000000000000000000B00000000bin/umountbusybox070701002ECDE60000A1FF00000000000000000000000147CEFAFC00000007000000080000001100000000000000000000000700000000bin/vibusybox070701002EC9B50000A1FF00000000000000000000000147CEFAE300000007000000080000001100000000000000000000000700000000bin/ddbusybox070701002EC96F0000A1FF00000000000000000000000147CEFAE100000007000000080000001100000000000000000000000900000000bin/cpiobusybox070701002EC8990000A1FF00000000000000000000000147CEFADB0000000E000000080000001100000000000000000000000A00000000bin/login/bin/tinylogin070701002EC9980000A1FF00000000000000000000000147CEFAE200000007000000080000001100000000000000000000000900000000bin/datebusybox070701002ECB900000A1FF00000000000000000000000147CEFAE800000007000000080000001100000000000000000000000B00000000bin/gunzipbusybox070701002EC5DA0000A1FF00000000000000000000000147CEFAE400000007000000080000001100000000000000000000000900000000bin/echobusybox070701002ECC9F0000A1FF00000000000000000000000147CEFAEF00000007000000080000001100000000000000000000000A00000000bin/mkdirbusybox070701002EC9130000A1FF00000000000000000000000147CEFADE00000007000000080000001100000000000000000000000A00000000bin/chgrpbusybox070701002EC98A0000A1FF00000000000000000000000147CEFAE300000007000000080000001100000000000000000000000A00000000bin/dmesgbusybox070701002EC7F20000A1FF00000000000000000000000147CEFAF900000007000000080000001100000000000000000000000700000000bin/shbusybox070701002ECDB40000A1FF00000000000000000000000147CEFAFC00000007000000080000001100000000000000000000000900000000bin/truebusybox070701002ECA9D0000A1FF00000000000000000000000147CEFAE600000007000000080000001100000000000000000000000A00000000bin/fgrepbusybox070701002ECBD60000A1FF00000000000000000000000147CEFAF800000007000000080000001100000000000000000000000700000000bin/rmbusybox070701002ECD0F0000A1FF00000000000000000000000147CEFAF600000007000000080000001100000000000000000000000C00000000bin/netstatbusybox070701002ECD1B0000A1FF00000000000000000000000147CEFAF800000007000000080000001100000000000000000000000700000000bin/psbusybox070701002ECB990000A1FF00000000000000000000000147CEFAE800000007000000080000001100000000000000000000000900000000bin/gzipbusybox070701002ECDAB0000A1FF00000000000000000000000147CEFAFB00000007000000080000001100000000000000000000000A00000000bin/touchbusybox070701002EC9B70000A1FF00000000000000000000000147CEFAE400000007000000080000001100000000000000000000000D00000000bin/dumpkmapbusybox070701002EC9700000A1FF00000000000000000000000147CEFAE000000007000000080000001100000000000000000000000700000000bin/cpbusybox070701002ECCEC0000A1FF00000000000000000000000147CEFAF200000007000000080000001100000000000000000000000B00000000bin/mktempbusybox070701002EC882000081ED00000000000000000000000147CEEAF00000116C000000080000001100000000000000000000000F00000000bin/mountpointELF(4 4 (444   0D  Qtd/lib/ld-uClibc.so.05     ܅*L 8    `)01  P 8$X>0F< TH$[T b 9`Xil  px$` memcpyabortlibc.so.0putcharstrerrorfprintfoptindlstatstrncpy__uClibc_maingetoptmemsetstderrfwrite__errno_locationexitstrlen__data_start__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__                   -L-ȆƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌP  --- 0GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/ -(M0 S R/Ѝ/ - M0&  0@-RM@P PЍ0T(0@ 0 @O-mM@` p P"p qPp xPP dP! H"rp80DS aV %0PU h  Q3 W  mߍh  P W < ) 1 (t \(j ʎN &j@ <P)t, &  /   0iP @X!1R  p Z ΍(t \(j *N&j@0 l)tP`\\  T\Qd \X  ` -Lnot %s is %sa mountpoint Usage: mountpoint [-q] [-d] [-x] path mountpoint: %s: %s dqxmountpoint: %s: not a block device %u:%u mountpoint: %s: not a directory /..0   <\  8( ȅȅȅȅȅȅȅȅȅȅȅȅȅȅȅȅAaeabi5TE mountpoint^.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink T \\!<<) ((2 88;6ȅALG M2 U _  k  w  |    L    p   070701002ECA150000A1FF00000000000000000000000147CEFAE500000007000000080000001100000000000000000000000A00000000bin/falsebusybox070701002EC7F8000081ED00000000000000000000000147CEEB0400081B84000000080000001100000000000000000000000C00000000bin/busyboxELF(4t4 (pjj444p&   Qtd/lib/ld-uClibc.so.0aXqC9!P%?@6*[tn$ @m+.?7y-5,Q j 2 9 8A`$ :Y#` Z4DvFW!}L)Kc5MMI^VFsH D~&'zxCO["]_#r(JN,33 'QH0P\0k* (R\V:LB)IAG;1dE</USg8SKR>;XW7BU_]<O==TJ/4^.Z2h >"oiw&u6eY%+1|N{fGlpa-bETԿ<0(t((4@, LXdT p||0# Lp +4D:t CO$X4]4e8m y 48$D00<dwHXT `Ll Jx00 jP H0x  8 %0-80D <P,pX8L_D0fPXu\4h0|t00T4 0Dd0 (40@Q L8X0dX pP|L  &$Y2 90AIS8\f p qy 0p $004<<H<T0`0l,x@     jd  0(0045xC P4`8a lm,@v8X~DPP,\h0 t0d040P$,40  !Z 00(4(@4 L$X0d0&p-|<0B4H@S Y_4f`r y8 0   H 0$  XP 0<HH ZT`0l/x00D4  0\%%-0 ,,48>DIP<P\Xhbth$o z,0D00(X (48@LX<d p|00 p )$04:A<IPSHmY_h7<o ,z$$00p<dHT8` l0} x0 )<4@H$00 X,,68H?DdMPS\x h4_t 0n4uP} 4T@00 (4@0 p   L@ X$ d p,& |-$03 4 >\9 P? 0G N X Ha dp u | $ 0 <, H8 Tl `Kl` x` T8  H    TR  0   l 4 ! ,0' 80. D88 P8> \LI  ih0Y tb Xj $t  ,|  4  @libm.so.0sqrtstrtodcossinatan2powexp__errno_location__aeabi_d2izstrlen__data_startlibgcc_s.so.1__aeabi_unwind_cpp_pr0memcpyabort_Jv_RegisterClassesraiselibc.so.0longjmpstpcpyputcharstrcpychrootsetrlimit64unsetenvmkstemp64bcmpwaitpidioctlscandir64getgidpopensysconfvsprintfutimedaylightcfgetospeedgetloginrecvconnectlockf64sigemptysetshmctlstrerrorstrndupgeteuidinet_ptonmemmovepclosegetopt_longsyscallmknodatolgetgrgidtimesstatfs64__ctype_bauthunix_create_defaultalphasort64getenvfchmodgetegidsetlinebufsetprioritygetprioritybsearchusleepexecvegetprotobynamesemgetgetpidgetpagesizeqsortfscanffgetsdirnamefcntl64getrlimit64shmatsetitimerpmap_getportsetvbufexeclreadlinkdup2execlegetuidsemctlsystemfeofmallocisattycfgetispeedoptargsysinfostrtollvsnprintfrecvfromxdr_bytespivot_rootstrtoulgetutentgethostbyaddrsettimeofdayopterrrmdirsocketselectinit_modulelchowndelete_moduleclnt_perrorisspacemempcpyfflush__ctype_toupperrealpathputenvstrncasecmpsetpgidsendgetdomainnamefreeaddrinfo__fgetc_unlockedgetnameinfoisxdigitfstat64alarmclnt_pcreateerrorstrtolpipegetnetbyaddrunameacceptcfsetispeedrenamestrrchrbasenamexdr_enumcallocatofkillctimestrcatbindinet_addrvprintfumount2mkfifoif_nametoindexchdirshmdtsetsockoptfseekwait3shmgetcfsetospeedoptindmemchrswapoff__stdinwaitumaskmktime_restimezoneferrorstrstrsetgidendutentopenlogsendmsgclntudp_createcloselogstrncmpquery_modulesethostname__cmsg_nxthdrstrncpyunlinkfreopen64strcasecmpsendtoreallocreaddir64bcopystrtoksigfillsetmemcmplistenxdr_opaquefdopensscanfexecvsetmntentlstat64strncatsigactionendmntent__res_initkillpgfread__uClibc_mainstrdupinet_atonregcompsymlinkgettimeofdaygetoptlocaltimememsetfnmatchcfmakerawftellsrandclearerrfclosexdr_stringinet_ntoagetppidtcgetattrgetservbyportregexecopendirgetgroupsxdr_u_intherrorstrcmpshutdownpmap_getmapsttynamegetpwuid__h_errno_locationswapongetcwdgethostbynamestrsignalgetpwnamgetservbynamefgetcgethostnameclnttcp_createatexitstrcspnregerrorstderrumountmmap64vforkstrsepfsyncfputcgetaddrinfosocketpairstrftimemkdtempgetmntentfwriteaccess__stdoutbindresvportether_atonrewindtcgetpgrpgetnetbynamesemopstimeklogctlsetbufinet_ntopgetgrnamgethostbyname2atoifilenovsyslog_setjmp_exitgmtimestrspndaemonlseek64xdr_arrayvdprintfregfreestrchrsetutentfputsexecvpsetsidclosedircreate_modulevasprintfrecvmsgstrchrnultzsetsetuidtcsetattrmkdirsigsetmask__ctype_tolowervfprintfstrpbrktcsetpgrpxdr_int__fputc_unlockedgetsocknamefopen64ftruncate64__environ__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__GCC_3.5_U&y  p t x . Y e p t       $ U $(,0 4 8 < @ DHLPTX\`dhlptx| !"#$%&')*+,-/012456789:;<=>?@ABCD EFGHI J$K(L,M0N4O8P<Q@RDSHTLUPVTWXX\Z`[d\h]l^patbxc|dfghijklmnoqsuvwxyz{|}~  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|       $(, 0!4"8&<'@(D)H*L+P,T-X.\/`0d1h2l3p4t5x6|789:;<=>?@ABCDEFGIJLMNOPQRSTVWXYZ[\] ^_` -L-41Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,  --- 0zOGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/ -(M0 S R/Ѝ/-L 0M-S00/S0Su (Op!G-0`@MSVP&q @a 5@  cF *V d  R`Ѝ<! ἃ `@A@@PTlz`U XXpP `U@@T ,f@P 8hb@O`!PPP;- M 0 Ѝbt@tt0M `B!R\@T@\ BR08 88^ , @ bU 8hPPA-4AP(q00P/ @ @P P @``0 S)P,P_PP P x@  (0S 0C0 80S凁  PP PA-M`p4XX1PL!7PD ᪔PgᦔPcZ^T ?V&U pT G0[>QU H<P'p`nP ?  K@P.@P. PA5@- `P|lЍhP ra  HD<84@j U HjhjxjPjjjjjij 0/,  ( 0@-P@0S  0 0.0 R \0TH 8P 0P #0!," 0 , A 0Q ʢ/-G. 0S|0x Sh0L S;@ @@04 4440X L& 8, @ (@ )@ ,@ 0@ $@ @ 0O-p̠\P ᵐ W !\@ a0 S: 1 Y:D0 0R( 0R 5 , 5 @-$Mp 008\#( QP`@U@  P P RBeU@$Ѝ, O-4/X,M@ @ D@p`WHtHT @pX4ğP@ Ps[1   ^`@0 PPcI PP0 @T3 P#xP C@TLCPap$pG C N@-1 @0 000 0$R@8@ Ÿ@#($ PP [`d2P G`Pr ``R0 㲀S@T ಀt1 P 0!0 P  S 00X0h0 )R00 ( Ϡ@TP 0 $$!S; P@0S A 0S 0C0 0 0C 0S00 A P 0S x@D1!^0ASc0)QU PE( ,ЍO5 5 , 5 0@ ,@ , @-`1P@ @ Q=pP@!0 PPQP@  QP@ P@ P 1\Q \^ UL@!D@000$ \ @@Ŵ4Ѹ400´4Ѹ48, 1E- Ppp6Aအ 0@ ```1 @< ʠ\,A,,,P@x 0Q0 Q-:?W-  \ `@XPL0@0Ť0ն3ń` XPL  ᾀ0@0d R@  X )@ $@ (@ < H < L& -k @ -8  -9 0@- T@M:P0EsЍ0&0   @@ @-@q@aM a0bXuPE ̠@LR A0S 0  @r00000Ѝ)0 @0B @)DL @ R" P@ PI @QYT H P   L <  @-`pMPU P0P `@p @P` UUЍ K|, $  jp@-P-=0@t`Q   @ p R@ 0$$ \ pp@,  @-@ $@0@-p@MlP0SSXPXPPP0 0 S 0 Ѝ08 4 ,  @-|`@0aMlpSP 0 Ѝ0 ("!8lS B8 4 H!O-0MS@ `p ! V2*p0 pP` @  0Q!P@PU 03@ӗAӅ p Q d0n4 V:;ЍO00n@ <  -8 k -9 -k; 0; O- M0S  QRpP#Q0 (@ b_D\X@  X@ @  [* pP@T 1ಀX T W Tl6E3La@ P@D*t # E Ѝ8, O-s@P2ph@F M ^` ТВЂ # !QNr@0Q@DTR P0 S0!S 3 #DV RCS7 `P` EDPUAP1TJ;8똡 20S   Ѝ@@0($ q 0 g Ƞ P,H@H2$0PU:  \` ⴠR r B RyB\ Q,PM(@ $@ 8@ < 0L8, X L& hKk,@ 0@ 4@ + @' ,  O-)9iɟ왟P@DMt@Sy P {똩9tP匩9 ɟ0@P|I|)|9\>P`P`I`i`yPQ  00Q\@IiPE Pp P00P ^@XHxà`3@0AQ0  Q0^P@Pȟ 0 ``S8(1S @@RA ]B E0B Sp0k1 >A ASAPF@0@P `@``P G? @!tW@@TEPDg)@8W@_,,@@@qu'0@0@P [PtF XƟ 0` Y0 [ x|lFp(4@lh`&2,YTY`8PP0`p <`Y~, `\W~lG,0`F 0 `$ 0`SY` jk00,AB ,0 0 S1*`Vd 4 $ 0S 0 S0R40 0R 0R(( 0R2( 0R,( 0R&( 0R ( 0R( 0R( 0R(0 (00(00R R $0ac ^  R Q 0$,0,`` [ `1 `!V#0c \`Y VW^:h#0K0A \ HY @0 RP[`V\" 0"` llb>.+00DЍTP l d0S4c"@4Ÿ I 0aNI iI@`(@2&ࢸY YTᅐ8``Q0P0` da \4 0l /R2 P@2P/ T T/^/P ,P܍P|P Ј '0@x0FAQ0 Qx Q\ s P `V, d  dL lH|P tC  ? P ;̍B/@ ' (P ` JO@ P |@Tf 10d 0\@3 @00@ T   t@Pb T@  TpP  ^2|P qŸdsk 0S-h`P)l d R%\ usZ:  S PP{m@ +R @ Q=: SV  SK  S<  S!  S600  S Cs(! =s"p u\ h0 0 r"", @ :R_ 400B$ 0N wY"", @ :R_ 305 /  @C lPP 2d >6D H@ Pmmm mp  mh(mmhxmm0@-<{^ PcUMd E!XcU@~. 6  > Š* 8 P @Ѝ0mmO-4M4 `P0 l$p d@ Q ( p8p $pC0Y P R 0-S#-0C$00  pp$U PYS P 2}Yp,p  ", ß 0 ^" S^ @" 0@"ႌHQ!J0!Q 0!@P@B!/0@PB|P09#901\(0 3 (0p A-qMP`p' j̠@ Z@P$@< S0,0 R P000̀#@P0 Ѝ @A 3 P$p 1@C+AR0, a;* @&0<O-uM M J<$@44 0@P ߍۍW`S PO8ȟV U0@ (UV@>P@88 80 S@-unpP(@`eW.PU @RP PU͍ A00P0UP, 000`4PP  U PEF2L P<(0L0(0` | u>/0U  QU P A0,P`CU0(SP$P`<`$ RP@`UP0PCUz͍0( C (` 0V(0$pAW1(]I 0S\ R<K!0@pp  \T`Ĉ` (p `PF`pu. 0RVB1 0P0 P4( 0n ( $R0 n̠PcPPVh(Q60Xzu.@q^0PNu RC! 04 0Y*,0 SZ  ^ 0$ ,0 ,(z HL0  RXGq^E4uP 1 4P0 4 X0 8\$*4  1C$00  \Cu.`0SW!` 00pG` 40!0Wp`yVp`p00` ErP8YA1YS&G-@M ̀ `0PP xh xv 8l<P ЍZ  P\@ Rh0<pS0CP03  U 8P!<,P!00$#8$ 84P#,P!0!8 0@ U0 @p 0  AR Nt 50R 0 BPAP pPU ( 0đ4\ :lp 8d0lC,\48Ą  4r R00k`qq8qO-8M0S P 2@ n | P Ѝn`"P 0" pP71 LRl@P@@ 0l @@`$ @P(P` 0  h@ p B?@PB? P+0B ` w  ??`Klb|i@T@P`k0PUJ Tph Q!: S @ @R q㰐PUPU `崀V@LQ|\k`弐 *"z0 @d0PV"P@p 0"P " 0"3 ?+D  Bk 8l0 0 ,   p" 0" 0 L@ P@ qqqqrr@rxq0@-M @yQ(0  ~|Ѝ0xP0 qP0kiPP e0EP0jrh00@-\ X XXP@00\ #0!0!$"  0@ @ @ 000  /X@ T@ P@- @@TO-0MPRp@$`堠堀 0 W@ R:X0T L~P   ЍzjX@ T@ \@ @ rSG-@.$A0@s05 aQq BLq(  0 \@ 0@B|d d0X X@8` 0Q`Q0dP PQPZ,0Q)J PY!0Q0J0^0 Q.M N^  0YS0 P  UT$`H QD Y.0fA`8@@,0PP4@<0(`4Ap :Q fP&M e 0 )&P0B  B9 $H.XTf @,$'@q q f 0 @T  0@0 0 S 0 @"0S ,0 FQ 0 Q HFP@P xPUNɍ ΍ 5 @*P@ڔ 9!C 0ɍ@& ɍ눉@&-0H 9z&]A @ ∹p)G0B[Xjp@T Rp0 䤟 `& Y P>VPNYQT p΍@WI@0IN @@PE T7 %4 P3C fp@ U#^@#x3ß@0D0X3P!ĠN@iߍۍpr )9@PPɝ$3 @p`p &͍ 19QPlY0\1`@Q< Q &  0PNZYS:\D 0!0C s @`Z9ɝ&͍ 0PNZYQ:\% `0!0Cs @`& 0PNZY Q:\ 0!0Cs` @` hPP @, IP0NP@ P R @^0@PY΍&]@ @ 0@@P Tdd )9^@>@ @ @ @ @ @ \@ `@ 0sHsss$tsBtX@ `sVtsrA-`pP0l@TЀ%@  R @@0S d|0@ @ 4P P}d0 d x dT@ X@ \@ hs xsG-M$ ,ce P ` ܍0LPS&P00 $ ,Je P$ ,De P @ @ P \^  RL 0  R@~/BP Ld@0S0002  l t | PRύ @ *~"Z0 @0fP"ʆP@`p 0"d ! xQ~hM8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8LhMLLLLPM\MhM8L8L8L8L8L8L8L8L8L8L8L8L,L8L8L8L8L8L8LML,L,L8L8L8L8L,L8L8L,L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8LL8L8L8L8L8L8L8L8L8L8L8L8L8L8L8L8LLwX,Oc$Lc/ nP00P`808 n " 0"|Hc :0* 1w 00@P@" 0"ɀ/mP009900P w` `` "@ 0`"xfhPpWp0Y!R 8bVO S[@ xtt@ ttt@ t<0@-@00$,\ 0"$IP 0&@-t M0  @I0SP Db$$4; 0"$(P Ѝ0uF0p3/@-$@cPT oup@-@P` 0|P 0|H$H0 0pp@-M` PRP 'p@ P Ѝp4o0o5/zx8uPu@-@PMQpbcPP v`vV@:tfkP0fA- @t1 @Rl00$P \@tT\ u`PpP\( HjE- M`Pt00@cT!h@ic`p'P` @ 0p|pP`QЍ`u ( hR@- @uP0 n0HA-PMPB 0-0P @ T -R RR" S  RPS`p@P 0pp`,p PPQ@ЍR\  R\ \Sp@-@`PmP BPpnpmaHhuE-!MP@)t 0` 00 cR3P.@FPP00 ppbb뜀圠pP`@ 0`oPp\Ѝ:$PP'uT @ ( T @ xU0@-d@d P@X|0  M3/PЍ0n@ @ HPp@-P@ xP`lP \ nUP 8n4P, P00000uuuu|iuA-$!MP@s1 @ U9!p `P-  hlX@P( XP#@ .Y PV aY@ @@P@@T64u H 0R//O-MaP9 $0@xğ Q3lDPuddT`T 0L0^* R:$  Qq \S Q*0iaPЍ@ P t=t# \R> @P`H偑ARTFVTP pQ[ ßH0S<  R*00 X R  00s @Tڄ 0 ^lŸH R~ P 03045}* 0E `PDbts\2 AqPAP` P9*X |1@P`0s T@ 0C00 C ,tIjl$]\p ]w w wxxx(x@xxxwThhxxxxxPx`xwlhO-PM` 0!0 0 0| P$! (, ipPV A ^P  XPiPV p(`Q q,X 0@Z@0m A ,PP   0   P   m@P#T* TPP  ]PP ^ $@T  q  l@P$0S H(@iT P Ph 0jЍ P9i 0!b P,i 0!U P@(@M l P@,@E T P@0S9 ,S@ P@  P0@ 0  Pc@$ d ]Po,h i@P$8#4PB 0P@: S  S7 o 0! 0!pP$p` P| ,P,X( 0 , P(5# Q (Ph 1# Q D[yxxH Pyyyyy y(yT0yPihi8yO-`Ÿ`BlM\"P`Rn0;008"8"60"000,p(2@U{8Px  YT Pi  ^P]a0Y P"e@_@P 0d d! 0uh{P TvP[P0 0 a0 i^ oAbP 0\^o 0U^  0oY@T 9[PZ@ T m ph m$hPz `zhzzxzzP b`zz(z8z@zyH-PM 0m( @-0@, ^  @ozA-hM PP @*82 R@`* R: 0S-*  RL !Q0 S7hЍP 0 S/ `g ` a * R@` E_P l_Hq,0P SP@`\ LQ `pP% /eP00 0P ?n@P  `A|0PD$,Sg$00A @ @ A H@ @ E-P Mh`(P\1\\A, 0L!@l ,1   1& 1+ 1! 00100  0 @ p0! UA`PV0 P$ pP`@`p^  `l!n08z z{@ @ A  Pi@ {A-`pPU/ -Q*0S' @P! @P 0nS eS\pp@ TP PQH R>   R6* P UX qH`V 0X 03045*6l 2l .lP0PP W 0H^  @R*P P P P0cS 0S 0PLU f { p@-dddAdaMP\! 0`@PPk@!1 @R 0-S/  PPPU`*P2PU# = P @#fT~Ѝp P PQ@H0P @>Pk fh ({ `{0{  H8{@-@l00@-S@ Pp0@-PMl0@0lЍ0 -L,MP Mp @0^S3 D @ < 8 4 0 , ( D`K  P' 0P Q ,P hР K,P  `~ sXP {|@-P0 MU@   Ѝ< p0P `V0p@-P@`P P %T/TQ *0DS yy,y$y,y8y46Xppap^npnp)X8|P|0@-S@ @OM0 -M0S D0p03ЍA -0MSq3 Ѝ 0S +p3P p@-r`PP 00h@PP PPpA h|p@-d`@`P 00PP $P@pA A-P "000PG AP|}P dR``@P`b` @ @l`RYPUP;q@PU LP)  `DP000ZWlq00Ppvth`@kTPAgԀ ~p|PzNP P Q`@kT`V\k`00N6kp|A ||||x8x|P@-M@Xp` 009@'P`PЍA @-Mp`P/@P%@ 00P j@`(P *@ЍA x|u@-Mp`P 00P B@lj`(pP-@ +@ЍA |Hjp@-` !T\ <T] OMK`\QPEPMP@@HP>4DP:(@P!@ ;P@6P7 >@ P0S \ 0=Tn >T TP@@ӺVT\=T@p@3<@=@P@@æ@P@Op|||||||A 0@-PM \@70P R <V8UQ$AA x||)/PG-P@ 0-S `!PnP `0F QPE@j`h!j`X1XqX Z@1 @0,UPP Ii@Pp7 !TWjVP# Q45*p PPEH\  0R4 5 *U HPI2hP Hbj@0PT ,h}  }PiHj  H}0Q@-$$ @@ j }(}E-QM!@hP@P00a TEpD@P p@Na @p  Hig  `aoyp@ ae Qau `*XHX 0P 03045!* `g ȠH`,HV  R 0304 5 *XEg e b  8} @} H} O-h!lM@PgX1TP !TpaD    X% 4 X 0`S$0A P)xQ) 0Q; 0A ^ 0PL U@PT .^' U ' pT* 0 JЍDHxQP @@|PPU P @xTplHjH0SUx Ud0 bS4;$0  BS ; P   Ё@P  `p@-M@bP 0SЍ @-M@bP 0DЍ @-M @XbP 05Ѝ E-P M@(`)a p@TE0@3S>긦TTTTTTTTTTTTTTTTT(TTTTTTTTTTdTTTTTT(TTTtT(TT(Z-Xb0   ЍEZ6XJ  0Z#X9uZX*}  nXLU eX2j 0[X/Q RX, KR 0 C;  <  7  07 0)!#O-PM 0-S@ @@Pa P p \P^ dH\o  @Rp*@ PPP? %P@@%Q bQdW  P' cH@TP P0U4P5O*  P \PPHP @ T*Y@  P@pGPPP 0g cSY @@PЍ`cV bPH R{ @T`*mY@0@C@_@\@ P@@@`0`*S] !尠 @@0`` .P 0 LRlR- hR+ W. l@pGY@@0*S? D!`0 @@`0`Y^ Y@W@`P P=@+XGXW@@`ӫ@pG`W@`@`0Ӣ@0pG`Q 0x P-Md]PЍ]@-` M@`] ppp p1 R' @` .S 8ZP`@P -LP.^0S\J`@PЍ0S(J`` 8 @E- MP]`1 @Rp# @PpPV  .U@ .\ R0pS Ѝ$W0pS< UM-PM@PG PM PT `p  0UcP, @ P 0?cP  P  0@ `@P  0*cP 0 (cPPЍ 0"cPuqm5 6 a`-PM__PЍT$^O-d M\!P ]Pq`DD!0@S010$ +B A pP1^`PK`P@^\^  09 PJYUi"A$p U00S@a!@`-P FPU*\l h <Hj`p@-`P@@T pp@ P0 ӗ /ՌP|/Pt0tM -@ ÅÅAP@ ^00̕ 400/~P̕^0? 0̅ 00/p A !A  H-p@-MMA@ `@D dM;^Q`P  0S0H^&   R 0304 5%*v Ѝۍp@Ѝ/PpHP  0R 0304 5 * 4A 0A  p - M P4 IPP0 0 Ѝ0SxA-@pPP␀`0W \@\ A}\@\ t,0pU`0`0K4A O-頲MpH0S  R 0304 5*d"dbd@T PUUX ,2T  ;@T @n QU A00 RD @ T- 0PT``TV X H^0 P 030451*T0\   \ $ @ TX HP& 0\ 03045**Ѝ  HPU ` V 0304`5: v pH  Ȍ4A H@l-M;UЍ\p@-`PV@ 7V p@|p0aU,A @-M@ PT P Ѝ< 0@0ST먂4A hjG-h@pH0S  R 0304 5r* " @T bPT U! F@T ?PU H`V` 0X 03045\*A00 @T) 0`TPPTU H R+  P 03045'*0TS   0S   @TH R  P 03045*     |  Ȍ4A Ȃ@lH@- M@P `P p T@͡U P͡P  Ѝ0S HO-h;h MPp`@ <+)p aP# gP5 FPh ` Q`^P pT` :@u[$Sp +$MP< d$d$@P>`@ t \10 !@-QX DZp@`@UT ` P- $PX @ [ d PH X  000 \PvЍ 0  X6\IP`Pi PU@,P B[ 0d V FPv  Rȟ8 Q_ (Q\ ȟ Q` 8Q 8Q0 w0x  ȟ Q xQ pȟ Q h8QM `ȟ Q~ X(Q{ P(Q{ Hȟ Q @Q^ 88Q[ 0(Qp0>p0 Qpd0u0 0w x0pdv@[a !W0Qp Q= ǟ Q: @T `V(0CAZXl0#lSX- l0.0lLgPaP "$RPL[, gpCP >P ^T1 R꼆Pl02.l  rRP0(cRQ ph0z hp {ddhp R>dhpXedh,d hT@$@\E  @PP PC@EE_ @T 0T dTT  000dT T0  0Aş$@d8/GEPd N[  `R$ kXp00p0 p0 p dh́0 (d hX, l0d0  ld$d nP(@< A$_Pyd< Pr 00 "Q0d< Pe ld.0 0ld0RX)ldh >0 ldhCXOPLA[) 0 Q$ X*pd0h,pd h$ldh 0> l0dhXd0;d0 d ;d0DXh0;h0 hhp0dh,0pd h0?V,(D P @P n!$@}DD@P\dmⴀ 0P[PP@`lPp@d@hdP`L 0HP 0 PU@P #p d $ hsD  ,A x8@HPX`xphȌЌ Pi0A 4A HȃHP (@0@- M@|PPhݽ U@X0H R  R*  Ѝ0 Ѝ0@O Ѝ0@ꀄ -@MW럿Ѝ- MQPЍW- MDPЍWA-pM0 `p@P⺾P<0S@P 0@@ QT@P4pЍ8Q*P  8A O-PMPp0+S+ -S% 00 `0 %喿PIc@QA XXXXXXXXX(XX0X<XX\00@ S`E`e  8zX+\`P`fE @@D! Ԅ iXeDl SWAPU @  p8D@@-Q\ p Ap  U q0 8pD0Y \ V,$ |$p $,@ W0@p0<0\<0040 P U<@儳,,$ P@(P 4 Pe\ [ ^0kc  Q 0A S[aV Q PU$0@e @f ᫼PA 0 BL SR( R( P0Q( @S@ ^0  \ BR0g cP ၼd($L^*Vp$@P@0< Y@< oVp\T!Ѝ<0 0^<Q4]P` [PU [cP i@P`YYBH(PX0  Px   H8P <PO$D00(  988A PiHO-!MPpT1e A失`nQV @J` pPþP SP 00p 06 q  \@45*t QHQ:@t@ PppWVPZ T듼@HPX [@45 *Q HX;x/H Pip   0@-PPh0MP X0Q@ Q ̽P @Ѝ0 ' DA -PM  0S AAHPp@-MP@ M0`S@UQЍp cA`AXp@-RM@`@p2@W@@ BPe h````H0tP(h P @TЍ@T@T@T@T@T)P"Pp3hⴺP ᯺Ph0 Sl R0` S"   ᚺPh╺PP RL&d ᆺPz0P S~ dR@A DA @-lM@`k PmP$UV lЍ0IUc P(U U p\ \ڈ0U a1U  R  ჼ0@dT  xHA $T T pH@PFD d3$  P  A0H@ R} dV $ $R  Q 2P` R ᗱP ŸAA nQN (ppGS렂@TbPt"P<xm80Pc@T P 8B@T"p3U\ N@T1@T. QaA,P% 1\ 3,ЍۍQ R5 (pHhֱ0S~P{\x<l58帯 TP PJ[ 喲@|T ]T  nB'p E R (@pD坱o<5:54WB45|SB @h hhA lA pA tA pxA  p|A 8XxxRؔxy)ؕȔO-PMP@A0 -R= P쐟 IP p:WP BpPၱP Z @``I V @D-PkP!HXp Ѝʲ R 3 aR/@-T@ 00 S S \S0 S!Ȱ   C  QR /0  /C P < S 00/ /A-$Qp`V7  b1p! Q0`b1p! Q# PU @W@@@PXH@ P `  Q*0  0PP@P@@@ 7H0@ `HA @- @` ˠ9 0 A-Qp  `PU @HFTP `0Q0 A-Pp@Tڠ`W @@ PRp\0`0G T 0 d0ˠSA A A 0@-P0@\PM  ^@GЍ0@-@G @004C A-|`pxP0S   Q  @GP@ p  PC 0C @-G@=G0@- @ @@0 00p@-!<` P0@ P E Ep0@-M@PGP0Օ 0Ѝ0 0@-@ M;S0S,0 P\ ̂ Ѝ04   s0 R   @-@ B9"@-@P 0 KP000#P0 0Q0A-@`6HPpUpPU  P @G @`@D0L0 @Ap@-@`PHAT @T PppG-@PP XH P'P$ 00qF0`S  QU @|HTPP0 Sp` ,GP!@F P ⼬ ]H !0 0 QDp@-`P@0\S @ p?\P  T0 0-S F\/ -0 M +20C 4C 8E-M(0SPb @XA A x ؗ#-MЍO-@M 40 @P`4[Y QV =$ + @~t RQ PP% P40L  ~O p P l2P`L TTE pPZ@` Ѝ/("p ^P" >OCVㆇ7 V] 1V V'<0@f !Pꘑ 똁pPV5 +VG V~OㆇP~ΊOㆇpVQ' P/ ˠ @ P h`[ VUpP P P@ P|  6P{2Pw( @RPl%>C '>%!>$C ,C C @-@ 0  @C p@-  B@TR< S6  S&  Sc  S" p@d P P2   D Pp p@1 S< 2 SL 3 S@@p_@0Q p Q1p SA[ H@ BxaPt SPL p@V0  0 ,P@<p   pi0`   Q q  0 0  C< 0pH ` q@n~T@, pP0  p%>%>C %>C C %>C XE-xx0M1hP!  TaTA@U#8 R 4P 8 8  PЍ @p p@PP 0̠0  ~C C %?C B %>B B ,C $C E-`PAKMp i@ [ X ^<p @0 00ЍC C C p@-aP 0S1U.*@ @P :\%    @P0PQ   R 0S Pp@v U:;  pA p@-P `<! S *@D\  =pP ``pA O-M@0  @ ,QX2`H00RD2H00? @$z PZP ,00P兦PPM4$00 @ (    ᕤ 0P`)(` f``R"  9R0pF00B> ` R \R` &R) \/R R  \ (0 S^` > B   ,R ЍpF0Qx`t@$@f` $x0 . ߦB O-MpP _$@`{uoh.Ġ0L 'S`93877,78@<@<4,4 44<@<D6@;@<:8::999t<6L<\=:P=76\3D64665P54840OpHN  0媥 RO !VQ @ 0G  ^p  P*$>QW$pЍ 3fb$ i} $du ͟<0S P y  PP 0 & P060p`H8PS@P` -ST MS !SP5 6 0 0  P 8 P 0 0 nhd%0F S=|A===AA=B=A@T^ ˟0S X HP@ڤ\d /$@ T7 Z*%0@` Y P < PR AT @T R P J@P   [ RHl $|밀` @ZPg@  NP 9 TFQ)K=&P p00ɟ0' ^  [ 0#0 P @$ 1#@ꠈ (¤P@H  V hGG,G@GTGFF>FGGGHP 0eP@ P@\S l> H0S S S > Zc 0;`<@]<@PNX;:  \ %p" ,P(| 0 ,P(@`ᄰ ZPQ`P @  t t0 |d0R/ SpP Š 6 `VD `㤰@\ $ZP0PP !P@`X@E U>$ 00P- { >)  0?P 0 >뿣> 0 C> 0 9=@ P  R 0nD=\"0S9  ?00ޢ!Yc 0(+S:( R.E@FDD>ECpCxCCCdPb;@xkŠ 6<mTP``Zf=cP@@: .  },哣Cj@፣ã9 Pb p[#ᴢ=L+RQ SBP  ^H"0@k= 0$4 6mS pS,Š 6<#x}0q|Tp #C  0>Pi5 6i<! 00  >P000P  0ᚡ  0>P  0= 0 8< 0 4=4C A C C 0C A <C A A L C x4<zP jPЍ$[P dp PC C $C (C ,C B p     A 0C ` ȗ8QB B A C C C B O-,M@$@2$G6p@TD P@T %T0%S S !0  `Pg $  !`V, ZcV@( sV8 $@0  00 pY @T$5$$ @$,Ѝ`0`@$`P el: 0 @K6  $p 0x -MЍ|HB p@-@R`P  T 0\^U  0 S 0 T p0@-S@$ ]S 0 S |^\S [S T R 0@ S 0 S0^S @-@M0p %  `P  `P@@T T @PT T`P T@@` Q5T\00ЍP @` !x 0 0 R/h p@-\@ RTP P`HPL 0 %# R pD D t mp@-0@0P` 40 a p  0@-L@PM @P 0PЍ04 @ p@-PM@4  n0`ЍpE-`MpV P+p@ 0Pp@ gЍ H0@-MP88 @0S0$0PЍ0D D E-@夀Me 0RPp` ^ 0R!PP 4P  P R000@ Ѝl   Rp@-P`@ H0S  R 0304 5*&V HQ \ 03045*qPp 㙜 㖜 G C@0 㚜㶜 @O-<ЍQ @T P PU PU :^P NP PU , @PH ,0 PUH 20 Sȟ 0,,# R, 0\ , R, R PU ^ ,r3@ o3 ,g,, 00 I4N P  U u 廙 PUl, 㝛Pk 2P,՛,P,`V@ ,<3@$gP 63 ,2T,m, ,@ 00Q= ,咙 PU8fP@ 3@,^ , 3q2TXf@B, 0 0\ ,i PUj,傛şQ& P,U]% P,U,R,0P  R,0 @T0   R, 0S PU1$Q@P }P xP7+ PUZ  @ , 0@P @1디@ (@ @,$@Pd$0@~@3S@T$1S$ Q P@  @R\  3@@ڙPP @ P,#(0S,j Qa  ,U<3 0[ PUVC0S R ,400 P @U,@ ?B寚,W PU5@R P0$0S% PU @}T PUP`PŸ  ,0  PUc P@ q@[P p\P &P@T`] @RpP(1@S(U `pJP@00S9Sp00 CAt 1^`1@\pPpp$P%| ,0VP0P h@@ ,02 ,,D (D D ht )p P`  P@-A M0@Pp-$^ 00 $ \^00\^/^'S  `/  /p` @ 0` /ƙ  e Ѝ g x $D G-鐖`MP 1@1k0 P娖 00嗙`P1@P  \\R R 00PS #S`nV%000l`PP rЍ$N0p  jP,X ` @  0P P!Q@: T sT@`F P Q^ cT0\S S  @ 0  0\S S`0@0 0S0`H0 pp`@   @ @P3  P@Q@PQ 0 ^Q  P呖 @f@PQ `VA٘` gQ ;Q IQwQ+ }Q pQ> P P_ PY 0P^UtP/ PRQO 0 `wR|/ #@ ^/  - 吘`tP( AQ?P" 0@   ` `妗@PP `J2 L1x+t)yT hP8T @jP@/ 0@v P/0 @m//^ P @ R 0  0 @ ^` D D x (@$D pxy0x@-M.p`@D* 0PS p5@1Ѝ@`!O-PtM` p T#卖Pe0@ S qqooroooo$roooo" pPW B0P "嬲 0S Z  R@P@2@lb/.@4ᓖT@f0XPlXT$D  Pp t h (xyHj D ` l  UD М 000 P/P Q/@P/P \/$E 40  BP/! Q/P/! \/(E -M0P S P@Ѝ$E -M0 S LP2Ѝ(E 0@-@P@ M0AS@0@C\Ѝ0@E 8E @-@Q011@1TH0  BT P0 SQ* (E $0P@-@@DT$E A-0 Pp`@ SS@@TPE\*0S S SO/a@A@T(E @E @-p@p0  Q L B P: Q P*0 ,0DS ~ 0 Rp0E 4E @-\@ [P`MpP`PpX,  0A0Ѝ$E ,E @-@PhMhЍ,P  P0@-D@e4b(_\TmyE 0p 80@ꠦ0@-PM@p PAj@Pd0@ӕPگ-P PP0Q@  <\8004P@Ѝ0$E Ws`  +; ˟ ``˟\K0@P0˟XW  ` V XW@ 0D˟sWdʟ(; @ T @ʟj P*ʟ0W  @ q&0F`Clj@ DT acɟ4j0CSaʬT T  NR(J `` @,P`5ɟ`@ FR@@0DT0-*`tYɟI` F?^`@0@CTTI`< (<9`LP`4d`Y P NU*` V| @ \x @T: Rr @ 0HCWT `P8Ht` @\`8 ``FV +-`W0L\0N G`PNR?QP``R 08P g`~W@ ^0͕r"͕2͕`q-I`m  ei`a&`0F*`XxHFf;x R `I `Dpf 0BR0bƟbW @@P:\0`CPP5`  eW 0& 6`0 _Q  s  0`%Dhe BR; Q] xş|0 0C@TB * R Q  R P Q R@" :P>`tt$@`0 4a`@T` c T P` 4@` {LP.C0CSwc 0 l_Qj  .ß3`#`@FQ`0 `~  0%`wL`Lp#P!P` <4 :P  `刲2P, P ,܈`@[P%T KPP@NP,T@FPT` ! 0 0 @@TTAaL\6BW@  WWj @ Ha0    0 0WW` l1 0TA`ZP `hi``AQAL`L @`.0lD TG PHE G E E E ТE P G XG 8@E  x 0G @H DH hD HH X,|p|D lD E آpD Ƞ E $E (E 8E WR G@DT <WR0 S@ S8``\ R P 9x6xF  a @4A`BT:L0T:N` "r8P 4PYFꬆ带@BT:*` Vw P@XPB@/ `T Vl xdP ]V[@ )V(@ [V )@X7P:P* R: 0aS*0VTL\gB ^; J`AQ"`@@P ᴃ!P@PwPq@PPht`[8iAJ`fN`@` (`Y URlI@5`Q@D†'P)H@l@`T:`i0@Thh@l<;:)DCB JN`& 0I^P:`  J N(*(`0@fP: `` vX`J 0P RPCR0Pn *:vfR+QU 0 P2SP aH`Jx ^{L``)y y@i+@N@N` +@pDP  cpPRyk 0D 0>`gp6`< PT? T R< DBP4x,A@P9s `ipW :' 0@iP[@P 00]@, $Pk@T 1\d   T X 1S0S RE P0aSAp Q p\\!0 -P3 +P *": S -P%X~0@0-P1l#Pʎ-P+T P  -T R k|p0 \ Qp R:P`I PI TI dI \I lI x XI x hI 0@-@MpQ` RP0@Qtt {h R  T{Ѝ@'|(P R D R$|I I I |I I xqI O-wglMhP00%pXT'7\@P@ w p  T0z\0 T0X0  j%P@T '7p 'Fǟ 6 & 6& PP0Զ00 &Ɵ0@@`0C0 @` d0SU 0P~ h@P &  460fSe0C0 eS  00 %0005 l ,P( Q ,0SIژ 00,04Cp, (%P -Q0S\\%P 0S  $zpP $P`$`U`! `T|P`P`U 4@T f 0 @}P   `}PU@ğP ,4Q, R ~\#0S3  PS#^=sZ 00B0CZ, ē@P' $ aPpjU P P a0PpS - @p}@bPaPŸ$: pW $0 S - |pG}Pd0S tŸ^ڄ"z z< 0SPK 2 PR\>0  JO|,0(Cp(, r3lЍ  R Q@ d}@X0\Yh_}0S H!PPh/  0az ]zPojX` z`[U ` \vzp` PG ,\,Q (,$ ( K,}눧 I I I qI wI pI sI uI |I rI tI vI ` xI  I  HjI I Ч)H-0M 0/|P7. zpW| R P P| 0  \ Ѝ AP v|~\ |j}~|)| R|L   <S(T}P{Hا O-eDM%<084PP@P4`l0@T!0@0L5,0   8~+Hp@W=`P,P`YT2:@f @ )8 00  q pp4W8(  `X R$ `H$PN<$H\ \45*q000$Pq Q Q Q Q Q Q00 Z `0iRq(\ ( {0p03S$0Pi  @ y Xp@ \!:#P W  R0#03\0@S@0@@ 0 `@ TV3^Q0 `P0  ,0P 0T  @T 1 @TA" APf{0S X HPD  R 0304 59*PN{0SH\=  P 030459*  Q @pl{^g{0{SS DЍZ0i RC'~z"x R{P zP0`0@@@v z >{<!` @H RI   X0@-@P 0  0@ @P ^ 0 Q   00x 4 -0MS 0C0 ЍL I <0@-PM@cQ 1@Ѝ0L I 0@-PP M   !x0U Ѝ0DP@ P yPtШG-PM@ -RP+ @DTЍ脐0 0pP PppP iPU @` a@`TzO{ @-|@LA4T`p 6@s`p@-Mf@Pc`p@@$+A4T`p 6Ѝ@]Q`p@-MD@PA`p@@ A4T`p 6Ѝ@;/`p@-M"@P`p@@A4T`p 6Ѝ@ `p@-M@P~`z@A4T`p 6Ѝ@`p0@-M@P 0Ѝ0@0@-M@P 0Ѝ0@0@-M@P 0Ѝ0@0@-M@P 0Ѝ0@@--0@ PP$  ww 00L  @-M ^0 $Ѝ vЍvL `0!L I 400@-@MT P@D!TЍ0L I 0@-Mi@Pf 0wЍ0@rO-h"$MdR 0 #\"`@H1  l Q*0Y 0Kvrp pkH\Q @TP4@5O*A0.  U@@T- W 0P ڌ!HP?  ^P45?* W puIYD0, `P.@' su WpHpW  P 0304p15: xp xPpvP(x %xx\Ku0Fu@`p`K( 0 Pi8x  `HH@p@-T`P@T %5P (0$0%,%5 %pu@L DO-@PtMU0-SD]@@Q pQ vQ Xy]@PB -R \1ww`P&' vvlp@ kvVv p  v vtPp  @̠\VH&vD 0/LbD`@h O$)+Ϡ<@ldd 㐴$ࡱ@ \P H R 0^4P25*CvPxP %Px^P$|,X@,LthY @nR+ tR8 \RE H\  R?0304 5*HPr P^\03045x*H0Sc   Ry* PNPvJPpwFH R\ Q 03045: bwP7H0S} P U 0304P5: SwP(H^ P0U 4P5:\EwPWX P xHP \ 03045*MuP't 0S 0̠\P tЍevP\`v?\v XvP\w?wtvPR<C$R tduh`d@\0 ^=鎲lp c 펲0Bld hd0hpx (vPHPd 0^?03045:?vHPUZ 0Q%03045*PvP P v@vv RtP v Y d@TşhU0/"b<<NV`0clPftPfX8 `tP`$ 8XtPX D RtPRPU   FtPF4 @tP@@ :tP: Y,@0P( ` @ @ @$ϠDC6l tP, tPP tP Y L tPH sP Y(e  s sP Y,V z @Tb8eHPU  \?03045*HQ  R*P T sP"ϠQN6l sP< sP@T.h 1`X sPh@"ϠQDC6ld sP,@0 P# @ *0  $%uP}Q> %nT0enS< ?Pl2cPcsPc\tP^ tPP+$4Qs) xuDIsPI?t?%tP@tP;?td?]u`YuP.(tutQ~tl&tPhp Mb8حh(0u8Hpų@P`000 00/p@-P`PT Ϡ@4b\@T@T LPps0Q  R81 /@-@] P  , k0@< 64 pP4P g 0"Rq\ Rj  4P4P  0"RP R^ \R P4P 00 CDR        p|@@0@P4P sRDP0H e^l A@00@S 4@ 00PCU4 0ԕ!0B10C}PPzw t00q n k0i PPf f ] Xp  DR\ ML < G8 B x PHh@ز((h -LA]KBM,@EM`(@DK(Mj0*KP0 bP jK$@ZP0*K0z RP- K0! `KpiKP0 @D0 Lj@PD@ !1@i4p `0p `_K0S6&m@q`Pp P W*K(K(JKP@( 0Pi4 0 @0,*K\ blpTPiPu8  K~3}ꀱtгPH -LM"Bi<@T 0S 0~ ( `0P/i0@T#1RMP J8@DA0@pAp`` @\ R ̠AL0S S`aV] R@ T np`@\ R <AC0SSD1SA R@T P|iW.*@(B RA RU 81^B  ? TRD 0  @"2l0l  0hT:$K R Rd0 @O-IM $M @ /jP:L0@,S,lHHHHHHHHHHHHHHHHHHHHHHHHH HHHH H H H HlHH HLl~ .jPʠ@P iP4A= @BwiPT p`ThWI H D[ k ^G ^ NhP: Q  VP k@P ͟P WH ͟0A0 cߍڍ @p@mj hxkmcHm@`H]@]@  G2Qp0`GVppTVà R.\Rk^0RoSB@P.T PoRo B @ P p C 0piP I`\ j\:\BU*P` 0hipP\ Q  @ p˟I} p$i 0KiP tj0S00e  Q} $`$`` 01iP [@0 %iP9 NjP P FZ`@Nj:P P>hP p*ʟ0 PP@Z<P 0j@P Y`Cm@@$ `h)P ʟP 0 @j) g 7 g@pj@P nL9 :iP i RO\BVK*:`P 0hP\bIV`P  0Vpp @@T PBiPX@Pp ph`P\(P`\@ 0S  `P0p0 %gY( HX0pSApC8p0!3P`8ppppppppppppPp ``(4@`@,@ <0<R00@00 >>>>>>>>>>>>>>>>>>>>>>>>>>>>>L=>D>L=>>>>>>>D>>X>>>h>x>>>>>@mߍۍ00  d00 J~ `PPFa@Pn P\ Ph L2^800C0 |`ac \ `bPE@ @`+i@P 2@@*\0p @ PL@AYL9QDp Ts VP~ 0Sg )Pb 0S_ ` p`pF@ᰠ<\Q pG$ YbP M :cP00@`/`4aUPQ (0  @ `0S V.R#  F.^'  ` RJQ @PȠ,80N  @WnpW\X`f `dV Fk\@oT0oS:bPP `/`P`/`bH'Ppp^U E.P& E0.S f `R   ` `p 0P ppppDUo^UEk\UoQbpaPm+qP #bP004P N@\@0  P PYL A)Q@@p  `P0  `P!p h `P  .΍   P Q IPPU vaPy` R 0@ ` @@@8#( ȠL2AMT0p p  p pQp `.bQ \w t@#))Q "P @ 0Y0Y0Ӥ9ՠ90P99  D PN  P/ PU  pP  I`Py P0N. P 0S IPPU `P p<^" [ X r0Yq^ ⠉変@YU0 ɝ\- @dD^$ QP`` VPIPnɝ@ɝPo_)@9a 00Uɝ uPb  I? zr`P 003@ ^y6`P1`P;PY' ɝh M M M M L `HM px L  P8xȹX -LeM@K@P^P01[2S.1[0C "}!_p fP wP aP a| ]PJ ! (K{$!T @`ม A a aP eYQ$ @/^P@0.SS   _-S0 0S.S ]P `Q Р]001 0`Q  HXT0@-@PAM Q @P ]P #P  ]PAߍ0^P`0S Ut`@-@P`AMPp7"._P:F0@-S-MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMa<0!`^PW V) Aߍp@S_6@P._fW! sW dW% iW  ^\0P Z\l0T QP @]@!_P ]к ( O-@PAM0-S( P! <]P?  APU@} t-P@*Q` ``Q ^P0@T_ 0D @P  PU Tg 1'    /V_PP iP80S5S3P^^P0 \ [PF@ @, [P 99 L 0 0 99[P m\PU@ AߍP  [P K\  \@P<3 [P@ @[PYB\U@ Lr ~ n\^PPvQs  | P  :R 0PB Q aBQW0B 0B0 S Pa0ESW0E0'"PPPd @ Rh 0 :R0 8#8RS] 0Q-SZ[R:R "J@@LPh aRY0 @ PW]P)]PN  [n_<[0,|Z( غP/@-@MpTP 8P#h@ \P=P PUЍ0@-MP@\P0cЍ0A-`@ RPp*V0Q  00O-0tMP  80l0h0d0<0@0D0H0L0P0T0X0\0`000 0$0(0,00040@ tT [T1 %TJ 0@ldh @@P@TYv]',l]tЍ\T# ]T@]P00Y0S J\@IT4 l0h @@P@ Y[Q;h @\ 4 P@P7 0ldh f@P`]Pv pf NPP)A  \P:n]APP0dlh A@Pldh p17P0lPdh P.P8 P 0X P @X@  PP@TP@`P @TPldh 0PPY@T lPU^ @4/@S]TT\'<lI]L\',lA] D꘽M Q0 ꠽  ` x ꐾp@- @`(P PUp8p@- @`(P PUpP   @ 8p@- @`< P,P PUp`  (-lM kY*P@ @0\lЍp@-`PP  t@ oPPpxPlP`P  LVp 4O $JHXXh 0@-PM@P  Ѝ0@1P p P \ P Ѝ0<Ѝ0@0Ѝ0@$Ѝ0@HXH0@-PM@U0@0P   0SЍ00@-PPM@Ѝ0@T \ x 0  @ @#\ <F[  00\  x  -G-@M`0d  `(000 00000 0$0< @TA  Q<@Q@@@4YPP @ЍGЍ/,|YpP 4[8[@=YJZp@ P4X0X4[8[,[0[ x[+[4[8[,[0[@,8"Z$,Z4[0[xy`O-錽匭dMp $P@,@l-@h uU0  (0P D-3Zp% a@Qhb@a@a@a@atb@a@ab@a@a@abb@a@a@a@a@a@a@aDa(\+\< P, ZpkZ(@T @@@@l Up48@P4rP@ PPPX ,1Z@Pl p @@@ @ @PF (S PP P  ( , p$p| PPnP `YP8` 8 V8 P @A8 1 0R P 800 ZP@0@@S@   0Sp ZxYPbhhj$LDH`} @ ` PP= P0 P \(D@8Th DP@Tc YP` @Vq@PPU @j ~YP@  R<  @P `jYP  QU @T<0WYP ZP Z- $X PP1 `V@ :YP @TX 0Y   YPv^ ;PP 3 ``8` XPz8@` 4XP4X,Y T Y(0S] Y0 p0ppX=YP {Xp,P &$^@@@A PU= @T@5@P1 ` tX`P6P  pX\ 0`P \ @0\!pW@^\cXT UT0HdV XVXPU@T @T P`tXP8/pe P00`Pp,0= 0 0 Yx4Q[ X_X 0QYP X^  R 0304 5*0S0 P XHP  tX <Ur 0PSS\U YY R0  0   0 0 0  r03\g P^  }WP8 ` tX !G) x>ldWPh 8 `V, @@Va UWP  &PPP  WUWT  % 8 7 Prr(M  ` )M pdx (0mHp(pxHPE-Mp`khPe@0 W0 S=S P @" P_Q 0=SS -S200 0 d @T@ 0  0=SS@0 fT Ѝx  G-餁p0`S P @PWPPW00g`0V0%PV! @PVP VP VP ~VP  t` k ` P` b@` pd[@ \`HTPH`0@ M0`,M pxP`hpxE-` MpVPV 1@.VPP:/P `V :/P Ѝ@-0@Px0P`\ PL0 P$(  0P0Tsx@-0@Px0%`\ PL0 P$(  0P0Tsp0@-0MP R@Q,T9Up P  S 0 Ѝ0\@SP D 0@P@< SV (M )M |i,M 0@- M 0S# );PP1 @";P% ;P @;P@ @2PU Ѝ0*W@pVUP 0BQ%P L]*P@q$P(`T08@O-cpM@P#TPe0@ SvlvlvlvvlvlvvlvlvlvpvY VW TT V@ Up T XS`P"># Sp LXtW[ PR^TP/S@PU`Y 0bx 0P"Qqp1B @  R  0@SPXq@ TJ ">Q^, ,PPAV6 U  fP4Z RTzUp @ | 8 RPd< 㺀 OSPXU qꘐO`LTIvRAUqRnR  ^RT<6844200 P HhhhXغxp@ -<00 1 S b0  A4M @-MM`PpU@PP `  RP0  P7/8RP SЍڍsT0S R`E-@M`Pp"Sp% a0@SO{l|l|l| |l|l|l|l|l|l|(|l|@|l|l|l|T|l|\|d|l|p|x|T@"ySpWwT 0000p_O ? @/Ѝ긡 ꠡ00p@ @`U@@@dQX10^K C DP@Q<<2BS]00ʍPD 0<pP *LOPs qppppp젟蠟䠟ࠟܠOSN  PSW00 P<R hOP*<0M `X8pxPhA-M@ \p$` 7 O<09X%D%L!$ ! VP 0TPw@t^o`j@R:00  ЍAPQPP0^0=|O-PMߍύ:5ύ ➿ ӟύ⏯<@/ 0 ύ3ҟ@DJ$(,0@BQ %P-2No_Pˏ 0 1Q.0 1R/ BO0 "Q.0 "R/. 3O 0 , Y0>ʄ8|/ Ql /Q̍ YPBl.P R R4 a  A\3/ @5 X3/@@- 0@<#PNq2SPQ\ |`0 R R2S YbV "RRPOQL\ H80X`O-PMߍύ:5ύ ➿ ӟύ⏯<@/ 0 ύ3ҟ@DJ$(,0@P bPV2No_Pˏ, 0 nP.0 nQ/ N0 _P.0 _Q/. pN 0 , Y0>:PQQ 1aQPP . R? R. la  \A\3/ @@~ X3 /@@v 0@<#PN}/ P/ P, Y:kP ` R RQ \Q\bV2S"RL\I2SFP BxP0O-PMߍύ:5ύ ➟ ӿύ⏯<@/ 0 ύ3ҿ@DJ$(,0@O PM2No_Pˏx 0 O.0 P/ M08 O.0 P/. M 0 , [0>1XcP0Va. P @\3/ @ X3@/@ 0@<#|`TMl/ \O\/ XO, [4wtPoH0@- M@ 0@`@@7O  <4("Ġ #    M ЍA-PMC  M@1 RMQ0 P`p,,<4!̎(<"(#4.LV0 ^ L`P0Q pP\`FU L`PQ0 LЍ kM((8p@-@MPNT/0T  `-Q R%T' Oq uLQ @0 .Q Q\@Tyt3ЍpP@NP 0   Px X -aLMq 0@ d@``PdP 00QL+`0"+0!P00NUbK   BRR0&0K"[ .A8Cȃ 8 #K0L NPU|Mt R RCMР KHM ;M ,a(\M `M M pM LM ĎlM h`A-MM1A QKKKQ2 R%0SNp`p` P51A   Pn` b|0KQ Nd@``@K8K| `M dM hM |M xM  -HL$LL,4<LLDLLܕ \0 0sJ k \M LM | pM lM dM Q|M xM M tM hM 08H`p P@-p`@@80 TM0  P-P0qS sS cS N@DT 0-S JX  Ѝ@T UM@T OM\M tM pM lM -0QLM`$q @ d@PP0 +"+P000@L 0` 0 KPVxKt0 R RK Р$KHK K4V (1N $N 4N DN N 0N T`hA-MK1A QIIIQ2 R%0SLp`p` P51A   Pn` b|0IQ Ld@``@I8I| $N (N ,N @N  , !0p`p0@9 Pp@|@tx@WC@,Pt@@9 @8PI0 (P  0l 0TP@+GP Ѝ``p(@X O-P@M`T$ @IP#00P@T$X)?@Dy$`Q $R4 $ $3P $0PU| `v* 2&r@Yp T KH렂 P᠂GPTP*㔘N   `'~ 0S d  @ L( = -000S*3C+ ͍  pP8p1T\ ( "4 *$A, 0 "04 [  GP[  K/FPlߍLHPh Pi⠂,H@PZH 8Bo0f @@^ ͍ :0@@1BJTP{ ͍ 00!uxpI2 @#   5E,@ _l0 `0"1E j E|  0 RB0 @ RpcGP0 \^GP@) T(H ͍E[$H@D2 aK/HP@  @PBH F }T@,1"yP"^*#B  > BPL +EPH O| p ZPxXp`gfff (0Q`غ0/N 0C/S/GN 0R/S/GN -l M0 0XXS Ѝ0<@S DЍDЍN @-@F@-|@B_PpM (`B(}RCE000 Ƞ (0LȄ@A 0`pЍN @-a M0Sjr %E EPbcAP(lȲ DQ Ѝhp^ PP00oBO@PpUPBO ^@~ DP>DC4 DQ :bN O-M)P`-COa/ EEP Rω0R0EU00 l)sEp aP lP ?PGD8 4 wC $I0U }00E U P`U@ 8@DD0 ]0S 25n⨢ q 0@  rC0  0@CPUpW @5n⬢ Q  DP <,  Wx7 , < \ 0pR PBU``W,<0 00,p \0VS<, B@ RsS0C0,0S  CWP W9 :W0pɕ0ɕPPG&Q/ȷ8tR RW 0SS SA|E\B '9 RF R < R eZ0!0 "( pC 4 0S p"p B?H((d庀 4 N(wR8`dPȀHX8x(' 0B08 04 0 B$ JC(0ALȆNDH Gx@EX ` 0 `0`$8  4劀@@EBS tCP R R 5NR#N0 3B R5 03B\P @BW00 'W̢BϠ@ ᜢN(`VhH 8CȊNHXF 0 P0Dhpp pp(D U HDx张Q0PAhPQ B HDxQaBo0@PE x.GNPx, @p ,@poPTPU p"p"8C(oB0R `Z0!0 ZB(Ppp$ QB,X'tmi:B㰀[N PP LP HP   HUN O-薟 M P`p&Bp@ g0D Sd&B }pp@X\ @UX Z  CP @:  @\ tA [r PE 1@ ]AP6 > @ @@@@A0 P \@X@@ P$P,@8$@#U@@#,T Q(UP,@ 2, o @0FT* ' dR @@\($U (UP0.$8 $# k@  0@APpPp `@`4PP R@`0 A`€ 0P@P< PL 8D@:,0$#$4 (Q"( $PQPPUP PY 0@RM  PO (QP\ 0L!RWWPSpPYb Z r3Ѝ(UP~ p0 /V@@Pa, Qa PJ i ,P] P@[P!P  D PD PPX0101rB @\ t i/A C @hn@\iW0SRQ YxE; I [?PH䨟@ ` K?`?븈8 ?PȟKo 0?PT `H0 ?Y  pqpq?p (hP0@ @ 0? ?ǟ 0?Pe`0` 04`> R0 00< |@(@ @@@@@( !8@ $0 0(@ @@$0@ (@"@< "<0$ D08 #D,L#, < 0( HFB@0&(6Ɵ 0P?@P% T ş0E  =>@(0@@0S">0  0^05@ 0  x>PڀUJύp,0U>pP F?0S P ^U( ^& @("8S0t@Pm`igt@PbAl@PYʈa0 Q R0 $#Ă Qğ$ 08#,# \ ^ u ,P@^ #Q t@T @v?X^|T =A Qea3 $!@P bX X30 0 08<,0S 8\tW<0=\  H\  0R 0304 5*Q  B P0SMߍTS= ? 8@4#h)F(  a@P? 0=nP,PoP@U @SD 80 0f< $ `P > 4 p a=P 0 0t@:\ 00 ]\@00 HPHX`hx Ph@-p0M0`P;PЍ0 S 0 S S ,A,   0;-Q :Q8 0 P P@@ T T @0S SS0S SS SQ000Q45* Pp H\= Pp   <Yx  -M=P Ѝl40@-@QR\>=@PV̖VVpL;P``&$# P 0P+PE &0A08 PLԖP 0@`QD K@80PcUiV㐆f夆fb Po [ fV ;P ̟[  [p ;b.9Pf>Qk PJUKm $ Ri6Sf X kJ$B 0-Pf:;PP$ f0Pd RϠ PY  B^5 |뜖匫 Y s80P ^$PF0 S/R x[P Pkf`Py 延[vf{:Px̪p[ pp~ BnZ 5:k$\ V:`j;PHH:$$DfP4*$  0`9 &9P , 9$\ P , 9[ Y:  0: 8P  ($Rt @ h @ @ 0  R`  P児 @:PPT P dP  p: 崽m ` 0P&8PJ K@Qm. ` 0@P 4(9P-=PK& 0  0@PKU@堗PTP= (p[ dG W  08pt8Pd8P<ǟD8P/^r0PE <:N  H8FƟV@D90 * *l`78 r 0P 0 0tp 0P T 0PN,7PP9,@79lȠk,,,<;[` 0P6X@T [ )l5Q0H0J E0 QZ\@8 d08@U8P h9Q TFP,8 e0E9PT7P R9\ &UY@@ \T R0 H4Q0ʶP#PUP 0S YQ $pW[N'9 P*P7P  / + <7Pdß,3@_0[|j΍/qvi*$lP6&6k>&JK 8($@^PzJ*8$ 0Pb$ 0  ;6 62"P c8 0W/0P) W  h7pB 5P>&A: ٻ9Ի `(Q R0 d B~xL ⿻B@ ⻻ Bl$ ⳻ Bd ⫻ ]奻 h 0| S Hjxy(8p R v(Hhx R  8hR H@xHH8G-`VP3ڤ@`FT` 7P2`FV"P@dp|7PA 0-SP<-PPP  k7P f7P`F V P Q ' `P Q7P L7PPPD7P Ph00T `FPQD T <`P 88S 0PXS x S 0`h`!8O-EuMQP` , F/ 6g/0B &A,0>U <R  $ P t  <PU `X< n<幁FP1  <0o?빁PEU`PU Y` < i<契F^1 <0j?,PEU=\ [  OP@y@3X@T 0S in_@Q @F o?P= P̍;=0@R@? <\d )uߍPU\ @`T@hl6P00 Le6P < <0 S1F <0e?PU5 `Q< < P1 F<0e?! nPU slPx1$?0`PU   [PU  F 0cN΍i)0R0+R"ʔlY` r>("$#,< 4  8,#4 <$0 nP! F e?+$ "[OP7P@ P  0PPPP'@6AT 0?0i>s~t|qtnQ 1S00PO$66 0eS p|HjhH@-4@@D L\0PD03$S @-`PM<p5@@ 1!H@ <4  @ 34 @ *4  J !4 0 @ 4 hh @ p4T W \ 05L0 Ѝ@5 ,3PP0E-Pp @8SMߍR8Je@ @R P0 s P111S11R 0R$ (,,0 0 8^ P  84P DR Q 0 C2{!>P@PDQ# DH0 RD@@ @2L 0 @<0@@a<D@} R 0S R R T3!R `J065AT P 3P  83!R ̠A 0 *3!R 0C 0 3c@ ~ 30R@G <00 0\4 R,P 4!R (bP4 rS CoB40sE ~ 94 2 S4z2cB*2 0 R40@  0p I400P @40@= 0(2O014R ~8 1Co @@0P  N0  02F 0p4$ 0\3$S (@HPX S xh8O-HʟM M| @P`P   @4ύ0ύ)30@S9   Y U0S zPS8DU~ pRP\Y *P9.P00 P0X GP7Y_ 舟`0@LP@0H@D`LpP| Ph>R Q o(oo o$o  /0n C00!P8pW P|  81P RJ 0 0Rd R_40S  X @H 1 0$  Q 8P YY [ > PS30 0(NT @TC 022 0 T$>S  0,.R  h0<>S . H 0 PoYY4  100 22^ }T/  b0h  "0 1wl0 1oh92 P΍ @ "D @0P  >A  0@@@ 2.R >  01N 0΍ N 0@PP2 ^/P;MܾľȾ̾оԾؾ. B .P# 2Qo .l  0Po* 0o1 0i1!嶴д/ 1K 0W1#ᢴ$S S S Hp P`(0@  @ S hx`hP @-$MP @`p0S ߬P ,G *$Ѝ@zG !G G @-0MpP`.@P@ .0S   0S@ Ѝ-M $Ѝ(A-@`P````````Pp-Q P0P0 0X0@-M .0PЍ00@ P.0P .0PPC.00@-M@P @P<U$7-P1Ѝ00U%.0P-0 xS tS G-PPhM@P~`E0Vd0pP`FVP@</Pp  /Pp /P1`V `FVY Z /Pd`v rPP$@ @$(,048<- " 4`-P|0W@hЍ0/P`Vl dPq d*P U/P.`VX @z}/P w/PP Eb@]@dP T P H/4R/P1`V$ @pI/P　^ C/PjWDP , T,@P%,# ,P D-0@=-0@ 0 ]d/P`V @Y*@l(廲/` Y,PP j,@P!A8(/S8 # @ AQ,@P ,|,/@90^@5XZ@1 @0|0 (@-@ u.0;8|S @-4@ 0P 0,|S G-P`MA8S 0f-ލv0S Q R:J Q Q  RRx0S Q' Rʌ0S Q(R0R08Sn0S Q+RRRO@  . 0 5 xEPb0S \g P ER_Q Pb P0Sc \U 0P. @ @, 00000 @@a @n R  oR Rk0Sh wQd* RV  [ jgx'eP I\ Db*XP < R`1S q1 R P 3( R L!R  Y 0Ad 0{,P!R Y 0A  0i,\!R Y A0 X,X!R D|  L,d!R 5Y A0p ;,`1S  P4, R T!R <q   %, -+ x PPP U \ 0SAP  IPL R l+0̠C0}H +0̠C0q +a R +Z Ri +eB@  +9 0K-,6PW 0?-9|x +d + P|S p xS (x S O-`MRM☆pV 0P0_V z`V\  %Pb\>0`FVp=P @,P[`Vh `FVYv ~ P.i  ^  P08<0 Z } @P P@@DP[[ 0s @,P @p$e@ 0@ P$^} PP  & PP*ߍۍ@1,PT\(,P #,P`V  XP'`V @P7`V  $qpW`vi  P@ 0@B P彯P`V pPv`V  xCldPs`V  H4 <xbU 00 Y0S #0 ,-*{bw YQ ~+PPz@ s*T_ژ 0+Y;],^̠ 宍@}L8`CDD@P 0Eḓ PE 0U'-b PY 'C f P AN0  \ X{AL 0 $@'=P$ 0@@@Pj?P+@`P<@[PL@V  tP0()PPU/ @)PPU' @΍ ZPf  :#pPPU  s Pw)`A <  0&oA.   0@0(P PU C0  |(P (PPU @00@ S2[\ $ $ ⺰\: %$0\ A <   0D[@ <X^㲀\Q㲐T Pz-N ( P@PU @*+ 7 `  (t%(h4 4lS p X@=Pxh0xp@-0 M S@   ` `% @& P%@P ) Ѝp@-L 0D$MP` p @ `% @f& Po%@P0 ($Ѝ R I%p@- M@ A% @G& `O%@P P ¸( ЍpG-`P p`0@ hMPP @0T X\`24PU @\'PO) RR)PEU!`@'P 'PJPU 1@ .G(PP  PEU)0S )SS! 1 TQ R0 0 2S1  01\<P hЍV'P Q'PK)Q/Qu/0)0E'PPU^ 1@. 'PE t  dPd("4̠$ D 'P<PU9 1@. 'P dnPd(̠"4$ ̃_'P &P')\)\) ) N dMPd(̠"4$ ̃> H&P,011 僪O'&P zF' =&P/0)0M  5&P0)0?  -&P)0)07 <&P3 !  "RA,0S>HI;4@T# $3 P#P s'DP$. ^s&P01&f&P 1!h &XV&P<&,I&P! @&P :&P@02 3&P PUL @+&P e 0"&P PU; @&Pt T ,pd&PPU* T ^%d8&PPU @ %PW  dV Pd0S(0L%PPU @%P0!0= dPd0!05  x p{ P ` %PPU @T&  % A YX 0@@@@ @@@@@ @$@(@,@P   S  @`TP((Hh @-8M@, 0P -0,)S /S  S 8Ѝ0@-\  0P@0 @O-M MT0`PppG_A  P9 " R R@ R R @ R#R R  0P  0P  0P  0yPDT T P Ѝۍ( 0` ( 00,U PE- MpP P P P`` V @PT P @`` Ѝt0   DRW 0SPT U T 00@-,@$$0$,Ä3@@T pE-蠟 MpP cP P P`` V @PT QP @`` Ѝl0 0 SW P\  T T T 0,T  E- MpP P P P`` V @PT P @`` Ѝt0 A DRW 0SPT T  T @0@-8@4404Ä3,,0,Ä 3@T  0E- MpP P P P`` V @PT P @`` Ѝt0  DRW 0SPT T  T 0,FT  E- MpP kP P P`` V @PT YP @`` Ѝt0  DRW 0SPT T  T @-P@0P`MXpX P Ѝ@0 R 4 0CPpU @-P@0P`MXpX P Ѝ@0 R , 0mPpT @-P@0P`MXpX P Ѝ@0 R , 0}P pT @-P@0P`MXpX P Ѝ@0 R , 0YP pT @-P@0P`MXpX P Ѝ@0 R , 05P pT @-p M`@p/1PPp pHP/00/ 80 @\0  Ѝ0P 0@-@ MPlGP00 Ѝ0D=P 0 0P00P P0 P0 P0 P0 P0 P 0 P0 |P 0  J0ST 0PS0 HhP`p@-@ P ____________0l |\@X@T@P@L@H@D@@@<@8@4@0@pHP`phP 0 P /'갳0@-p MlPPd 0 =)P - W@ Ѝ00S@LT`@-Rp`@M!0! c 8,#4$ , ЍP p@-`PỲ@ḲT pp@   0۝P@-p0@00000M`TPP  U000PЍ P P :P U U PP  P  UU0  000\   #0C\ 0 L R.\^X`@-M@ PЍ偝R@-@ P vs0@-@Q MP Ѝ00S >0 S T RPr ť0@-@Q MP Ѝ00S 0S T  PR P qš0@-@Q MP Ѝ00S 0 S T Q  A-@P@0@@@M`@p:P`p@@Ѝ.P /P@ `P Q0 000X  P \ !*`X /00XR@-@ P ʜǜ0@-@Q MP Ѝ00S 80S T QP   0@-@Q MP Ѝ00S 0S T P3#R\  0@-@Q MP Ѝ00S 0 S T Q  0@-@Q MP Ѝ00S 0 S T Q  @-@ 0 0  0@-,P@MPa 00@Ѝ0, U O-M_P {>΍ +;p C0@3S3\j@j@j@j@jk@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@jtjj@j@jk@jkk@j@j@j@jk@jkkkkk@jDj ߍP@TPtP\`P`iJP =  0 0A̹SP\`P`AIP ៯  0 0"m\if@9b  _$Y ɟ U(k8O@pȟ  0 @: @`P@`PTȟp D 0P$p*XppW$ x  @ @`RC G^_?cVS 0O@@ T`I ^ l? !0S ^ $@ p P( \@  PP5 P 0S3ZH R5z P  pF(4p6 P` ` R񟗑 ponnPomopu @l&0T 00 xş  < 0@0@k%@i΀6Tg@@ lxş`@FU`EP^`R @%E  `0S  ?K3 P4  ,4 , Í 4墑x3  04 A^ `00 4 R^@T ΠÍ (@X U ( PUU U hU , U U ųxx@phO-M@ -`   -P PPߍz !ꏏH  p4"tP: [E\/0B P Wʻɚ G 4!ă \OD ͍@ 㾠 T 0A@ṐT峠 帐@G ( "4 $, 4 \ $   TcSc@-MpP`@ h T@A02 R` Q  Ѝc @-@z d700 R50C 0  R 0 0 @-Mp`@P@ P\V0D  CP ߍ,0,C@D 0P@  p@-M`@PT 2AP 4000C@D 0P@g ߍp A-MPAO`pb 2`}  6y |< e000C@D 0P@< ߍ p@-PM@T IЍp`P MP00881U  @-M `Pp@ 2P&  6" $C0D ߍP0@-M P5@P 0P0PЍ0@@-@0M P@Ѝ6O-   H n@|,^,\ k  0, {lPv  0l 0l@ @ _00 [ d` 0 ut P8_p0uxUO-8uM\ @PT Da 3DP:< 0 0  X %d  $, 0 0@P$`(8 "$#4 $̂%L @`TTT:ᾩL@ 0R P_DM ,` VK#^ ,@^M 0P3 ^ P@* P\ P /PY 5P (PXPW D+΍ PB BP񟗔؆؆؆ԅe,V C `PߍS2 `",02Q R²ύ¡ X0`$@u R,xp^| /PUs !o l uPhYd2 6 Z@ -  &T  U# T3 0"SZQC Q? <U: 0 0.*T(Z& _@P P  PPPPZ  Q Q0S Q HXU `(G-MP蠟`2 $ pV 0 P *NP0^:^@(`( "4$$@\@  P @YЍn@`@ ` O-CM]PL@xPH $0S,p*P `P0H$Ġ5L$0pS R (@T P P`P H R T @X@0]]Cߍ4@ 0d0@ L xy 0@-@PM@w P00 Ѝ0lP00UxO-"\M0S PP @ P R PPZ P PO  P00# P00< <P $6@P g`*P!Q0  A Q0  P0\ @P PP p7/Ph 07/ V\Ѝ ( `PXx `@-M@  0p3Ѝ0@-0@MSP ]Ѝ00@-M@PPiP0  Ѝ0@-@Mp`PPP  9 ( ?ЍE-M8@Pp% ( 0S! P P P sP`|@P !`FQ(dȏX`Ѝ`V  0  @`NP V |`?PP``   0`|`3   Ƞ ,4l,, `p`3  R   l,4$ ̃ ```p`3  < X0 t X0-$\ D ^ 0S R d0@-$`MpV LP0U  @ PP0Ѝ@ -M9H0$\  80 Pࠁ Q0Ѝ @-@T#3O-MP PPU$0S`@# P $@Q UDp` Y0p 0 Y $@QЍ p@-@`P@P  P pA-8a(L"$̠X <Č%4., @0T 7@8,#ĠT <P,: ,T,Ă$< PP XP|p%P X qP  0}P { 0 404 P  U p@-`P\@  $0  ` 6`p@ 0@-LP@MPL0? Q,0 Tl \ Ѝ0@ Ѝ0 @-M^Q p0l D@C P@^Ѝ 0S00C 0 0@-MP H0 @T  3R F@Tߍ0 @-M@ ߍ@-HaM@ P  $u3PhP p$   $R ,L,%<\$.<\+:( "T L< , P 3 @T 3\ @T Y L  gP$"ߍ$ A-r#M` @ P(BXP(B# (" ā$

Z`F  0p%@H%G'΍@@/8(,0  J)0N'@@0  $0@@6 N'ύ@  0 -@@ j ߍ e @E-/M@`- /P (̠"4$ ̃0S$0S Ѝ<P x\ PpJP @峡0 T  P000acSc0@-/PM@<UC<#u0ˠ P @0L0 5Ѝ0@Gd00cSc0@-Bi/MP@P 0P <Ѝ0  @ @X00@- MP@0@  0l Ѝ0@ A-0 M@ P` pQ0 w@ 0CP ?l P 0L Ѝ 4 )p@-PP@`@  @P``ppA-PP MB tpP" 0) Q3 ` P@ 0CP@=P( 0p@ Ѝ 0}@ s@_TxxPy djXf@\  00[  V4U ,P(x 0 R/t4U 0@-  0S@@^1 212!!!\ 8U -H M 1  S<0 Ѝ#P008U @-8@ 007  @ T8U - 0 M! @0W Ѝ8U G-p@M@` <`PP88<#$#L 0,8B0p4p@$ 0 p@ @   0 P , pp@ @ЍrPnPE-$M`p  @P P70 1W  P00" 3 P \'  PP  M0$ЍDi4d$_Z` O-\MP @  p@yp ` 0` p@ <     ZP `徺ᲀ崻P뼡!`ⶬ,````p: @0< p@E!` p `  0@@0S 0Q  0pP'1 khp`hW Ѝ0< 0; P  S  P ^\@0 v@0i@-TM`pDQ0D0 Q P,$040( !   @$04(0,PD K$!5 0D@Ÿ$0徟04废4(嶟(,岟,V@-Q+ @ 0@$@ ,(0d@40 tt0n 400$ l0`0D<TЍPRP{H8 @G-3M @ PT`-QPD( V9 Ur `` mPU:0@d  @P L屖PU* Ѝ0lSS qS;  |PPD@⃉UpP`P P@W }P Y PPEu lj`PYP;DkP@DTP 0P-UPPD ? RT@P  &P @PPkC%@@Z P P@<T @ s  Rx xh@-MO! } 0A 0D  0 T`` ^,@V`ppFP 00B( 㒖PP 0(@S   HwgVP00ćЍH0PA-@+zPpp!PP p@` P  0DEPP$奕P0WpPx0`/0`/0`/$ 0$ 0 `/@-8@M`P pP@TЍTU  qhU @-@0 LU PU -bL$M<K4K-40pQnF@lࠡJ 1 0 kH p B a0Z!PL@ D0 @ `DP @7pppp!p@P 0$W 0\6  0 \/ Q/ ᚝0P-[HMPPZ<@`L@ Pۛ@ x x0Dd< `0(K/ ll0P,ṠDU PU .A@U dU `U LU $O-PM@<+PdP $;r "PZe @!8K01 P  H  D \ /DJDzX2}ύ@Iz/{? 0@O bP! @B 0( `8* 0˞P u<pP( p'䇟b0p,00`}O Q?PP5 P Q{o z΍>yO@@@ `p|~_t,?@PPV !1!"% .,Š#EA!05喝@Pᒝ叝 0'X4A!4XU uT,,p.$%l@d_nX  CQe,,` ` 0l@b @@ @P0^03074 Y ,0iP_P`*4P0P20#0%* @RW 00^PE!P0ϠPP?#0%*P%@P?#0%*{o@F P6} {/Q?z/Q?Py/Q?衍Q?.1 `a 0P6PCP;#0%*O@D\ Ϡ1 dA6 ㊛A6 ホlqa圱堡@^tQt!tAtmP:EP= 00}I~@ G(PKN@vPP0#0%p*|@Qjd8?pP: P?0_@ AR2^PXP:AP<0RI@H ZKK:P:>P<00EAP@ @tߍ @hU lTU PU LU dU @@U`PgfffԷ0H`xH@-\MTP@#0 X! 0Cq `Q  Kp, 0n>Ϡ@2l#o <EAfSg   2HhdP$Ƞ&(.H &h,H'x!"(#8D`\Ѝ((E.P*0/U //Q 0QAS R/!q\/R:// 0 L0 /U U 0P   0S0Q0 Q/ R Q \ R   /\ 0 bA/\ m۶ - " <C @4Q^0000 `00/  @-00000@ @ Y    R 0S // 00A S\//0_S T0 / 0S _S  /0S/x P P<  8 /00((  /8 /\W \  0S=S  0S=S$ ' `0 0 a/A\ 0 P  0P=PP/=P=Rb/0@-0MPS 0P @~PЍ0@wЍ0 P/0AS0/m0@-P M0 0 Ѝ0@_][PA-QM1pWPACJ00SP00`6g@pP8P @`@T p-PP`PU PЍ@p@- `R  0S `P`'P d 2 d@PTP@T PpAd[ @-@TP 00@-,P@@ M0BS Ѝ0Z $0 U U U p `0 R TP @0 R 4QU $[ Y W Y d -\\ Q 0MCP Ѝ00P$ \0U $[ U Y U U (( -0MSЍU U 80-M @ Q\ЍU U 0@-x@PMd@ X0R R0S,0, $Ѝ0@U  Y    @-`M 1 PS@ JTpPE @P *u P $Ѝ@U \W A-(q`0S !PP Q  V6 V! R V`Q @@@@t R0hV00`P 00@@@\P\ \ U @-D@8@0 S  @A@U |\ @-PM0|pS`1@1*P 0S UP`V@:Ѝ@S @0 R@U \  0G- '@p`:R `R %RPP:Rp`@0 S S :SR`R`T@ A E? P CP    @@-#0@, S U 0p@-` @ QP P 0R S S 000 P      0T80  p@U  U DW U 0@-PM0@0PP Q0< ( (0$Ѝ0@VU  U U U  0@-(P(@M0S PЍ0 U (-M 0'Ѝ5U  4 -M 0Ѝ$U p  @-P@0 H0S  ^45*@U 0p@-#%@U`  @JU p@Hp@-\@\ \P@\LL0L`  00 E p@U  @PY XW @l- M0 0-M 0 0@- @/P0 Q U `G-騠0@S0 @倐P`pP U @0`s X0,G}W U W @-@p@` 0M@S  PPPЍW W h@-A R QQ 0-S 0 S -S00! 0S 0:S0Q :R PT 0\0 @,_0S WY Y Y 0@-@MLPU@$PPЍ0@-PM@P aT00`pP@U P@PP`W@ЍdPP0 P P00 (@0@U d[ Y  RM 0S80 lA $0 0\W 0@-pM@ p 0S Ѝ0@PP R 0e  @-@P @8-M 00 ЍY @-PMpp`0W$ʘ@P WPg J@@T \ @TQ0@T@00 BЍwY U  -PM 404 R    Ѝ0xW pW tW U P@-@PX00S H @cQS ;W tW pW 8E-P1PPMp@ %P 0a) `R aT W ` ЍQ %R+R -RT` @`KPp?W㜠T x`p :/P Wh`p@TL P*@ @A,@L0\ H 8 h ( <X \ \ -M{P Ѝ0ThA-p@0T`~T~_331*|` l \``P00 p 0d0P11:  U   Th-M$ $0 0B @Ѝ@W HW R@- @0@ \0S -P R  0SC  0@-dd@dd dP0 M0 P4 00  Ѝ0U  U U  0@- @MP}T@ PQ ``0`   Ѝ000 @0PQS U  U A-\P\\@0pS` @> @@ `@p\ U \ -MP Ѝ0Th@-0@MS` ``QpPP PP0@ `p  ЍY @-@PM, 0Q0a0q 00Q DtLLLLLLDLLLDhhhhhhhT @TЍ Ѝ@ 70@ +@ @`W dW 0@-@PM $P00@TЍ0`W P@-@8@,0, $0 @U U  U  @-M@`pPxP 0 S h DDT0 @0 0 `0 0`pЍ@U  U U -M00ЍU -0MЍ 0@-PP M0S<0S @,T Ѝ0 W \ 0@-M@PP Ѝ0T0@U 0p -@ @-M00@Ѝ@Ѝ/U -M r  ?8 $0Ѝs Ѝ  G-P 2  Rt p0-S@ +SmQ 0X0cQ  R1ppoQ -Q00SO\ 0 QX @`V$r((X.N `0S  S  0AQ^^ !\@0 SZ@`0  P=`VA$1  Q< A P6 4 +P.CP Q  2P 0\  r``T RXbSU U  U Y U  \ Y -M5p Ѝ0@-MPḍ@@ Ѝ0@J0@-PM6@0 @@Ѝ0\ E-M@PT7耟pU `PP  %ЍR @```@x0 l0@Q PP Q V ЍE{ 0   W U Y  Th@-DpD`P M@b0dU dQ:0Ѝ  0@-@PM Ѝ0@:0@-MP@/ Ѝ0@A-(M@0p0 ` R "B@f\ 񟗉HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH\hW& 4 :  }R `\0 00S { 00S Rw"00 ЍQ h  ep0P& ! Px R`" `Xp} p M@<84" `& A\        p@-@PM% 0Sv (0tdDT\ D@R@Ѝp$ QQQ@ P  @Q@QQ`000 LR P08Q4Q0Q,Q(Q$Q@{@TPPP 8@@T W~ Sz@TxPtt|x8, 8 H P X h ` p x   |(     @  |      0 0@-@PMPN#@T U( 0S ?Ѝ0(G-|P`pPU :@`T X @PU*p P P~00@\ \\ 0@-@M0? T03S8P  wЍ00  $  O-鼰p开M`Pᜠ@T@T 0V Q  @ Tp W:0 S Y `ЍO \  PL0H0-D!!" M  0ЍU xH0@MP8 U@  x! \ @TPPЍpW }pPP `%^7@`@ R  R 0SpU U \W Y \ 0@-8@MP 0  H00Ѝ0\ 0u@- M`Rp2 0 R8HeP "`1 @ PT P@T XPdPЍ W T R ᷈ =@ B\ |\ G-`VE 0:SSC %SA @%S 0S:Sf ᑈPp0WW VP  /P ^ 000%S :S0000G@@0S:S  @T:T0@@  |W E-`MPPP@[p1 @T( 0@ \0 LRD 0 N 0SЍ ;ˠ!P0   U! P尀` =p,@ 0 p 0 00^ P@PL 8j,<$9xU Y H,C@0 88 E-MPf@P SP aPP HP@P! 0T  T0@T U R# U Q lQ ` 9`  0 @PRЍ '  @  aP2 /\29\+`p9\$ 0A"0@L`_p`p/\\ ?F,P  `@0 CP84@P`pP LY `    x PP/k- M ⍃P ЍO-鸰M`'"'@hP )p0e``UPP  @ d`RЍ Xp@-hM`10@T3 PPP@` P$ P? T -\0S@ 1@P1S cPA >PЍp`@PQ   PP@ @{ 4,0@P\W Y U Y   @-@d @ PG-p= `V = P PPP00U `  p`V P p@ P@ Pm`P`@T @TPU $ 0  pU d[  G-M: ~뀠@ p`jh@_Re< ?`a@n[0 PЍ A-Mp  0 `H`~0 QV : 0eh h `RP=O@4P @PЍx( \W -PM PP p#40 R ЍЍU \W Y p@-PM @0-SPO ^0G S S0P 0SW A 0Pf Ѝp1P: | R ` %R @P PR @a %?@P0PP @P@PP sPP@@ @0  ㆁP <0@S,zP$v Y 0U Y X  O-\MP` @ w\ЍV0! Z1p0VX0 +0R0B S VX0 -0R0BP>! QL)0 Q NY" PPP2@ PP!0`S0 9[ @ 0 00P ` OP峄@ 0! QPL)) \   @-pM`7PT0@T PU  @TЍg@T\ @-`MlP``p+Pdd @p0S P@ GQЍ Y p p@-`P@0 PQ  PdH@P@ 0S0 p@pU |iM`P  @/mPp+ 0 pW0   W00~    @ 0pHhQ < PPpZ@?@P PUZU U P|W 0@-PMPЍ0$@@@20 Y  E-PM@`H@P" p- `&0S S@ \S S 0@0SZ00 `` Ѝ\Q@0 0/S \0ꍃf0  pX   "pp\ O-PCMU,:@p (0PES pWJpGPEU:@D[0`0  P`ЍPOpG- $pP@Z0`0 P`@ Y 0SPVPPE-apMPQ;J0㤡 @P@@.   !;0,R\TDP00000000 PR000WP l Ѝ輠pW P T 0C 0@@DSP0 PSPPTALQ0 P T  BU\ \ W \ O- M`P, Z [ P ^ 0 [ Q 0 SV2P  ЍB(hhB:0P I  7 U  \W 0@-T0MPP@P 8@R @$RЍ0   \W 0G-pM3 PU 0-Se /S& .S xSPpP0l lp @ `P \ l0S0.S /S S`B0 ? @P,_2|PS*2@P S P 0S P^:bpЍ0 T uP"PP`ԑ/P@ P  @P  @ 44WP"`PP021@@ dŸ `ld24@T xZ Z` , $00 RV ,i P P605VN QT \D Vlx@PPV \!$0H@c 0P< G!0( nF( PA  0( n8p`V o(\0<)& P7 x0 R 40V( 0clH\   Y  W \ Y LY W U O-5,Mp⢟0鬵 0 0 S_ @~T P0 M lş`@` #@`V 0!V0S@T :Vp =V V FPQtQO`PQOQQ@p@@0w~S @Ѝ  0 P\PSPUPb X /T :T @T T B  ``Cß0 @ph {T@@D S%P /P W@T4 QAQQ P VJ b@\ pW@0SpG@T @Te @`r`3 `V tŸ0pGP@B0BQ@D `@H`ePUP@@:@"U0  T Teb S] ``\5#`P ^@pq@ p@nYv0 <0 h@~ NP0S S^ pP `:봐Y 댠 xn P qP 0!03\  U \ $  Y `U O-QpC⠡WM` p`@ `pil1 PR \00 8Tp`P( T+ @@DZ,p<``@ 0@T @ J0@<gP9 ,bŸ @@ `t P YA\V W0X pP 00S0SP!PU pW @,0PP6$0S  @T00000 R0 ЍhP4 @c0Sq i\  \ \ \  \  4\W Y U \ G-DPPM00J $``@ `BPlpBWa[[|\]]]]\\0 PUP }m/ pPW X QqS  B\GW j@T"XP Qx3ЍP\pPTT @@)PPUPs  2pP [pP m/pP =m/ V P" Rp ;0Ap 0B,0 `(\ e0P U PPhP0x*  R m ApP, P: S h R" p@pp- ` ms PP 0 _m pP;l^`0Q d R,  Y |@ @h h` a_\  _W U Y W U W `x`$  \ 0@-gM0PQ !8P 0p Q`PP0 R gߍ0(@U U U U 0@-P M @ PP0@Spapapapapa0a0a  \ @ @T Ѝ0  2  @T@-0M@SPP`Uppx pP U l0Ѝ@\ R76`U`*)U U Y E-ϟoMP0?@ Q@ @ `@$@(@PBPU v @T 0V" ?@aPK P񟗇egTgig0hhh$iffDfepfpeder` V 0VqO!pP P T `pT   Q$ QU q @ TQ ^A q=@aP! DRJ=3F @h@`U =WP>%T6 :T #TP Xm0P- @fp\ R P =WP `P` @T ( (5`kPU v 0`0*`` R @TiP @`<@PUP@e XX  ` , a24,,,̟@`0P@ߍ$0SAP``C$`P`+ R? ^<``P( |@^N(@P 0E0``$$` R @ 4 ``Q`OP`00p@ P Q\P `P$P \"P ~ \P 0`P` P~00@@@`P PP`VSw00`PU R (`V ``p,pY84*P"ɟp IQ98`b,PUR PyD@TR P@ 7ʂQpL pEp@(P{P(T ȟ}P`{T`eP p_T h0 0D Ph Uo @0 @ R@ \P `P<ȟ@U $h  pU 2So `0S,0XpS0p GPp8Pp'X:@ X*"hgR@  x@P02r 0Dg4 DS ^{00@ z@`ƟQ^~`@T (`V ``hƟU @p@,_P tf0  # ƟUP_Pe 0P`;! DR@$  @r`mP`00@U9 @@T Z P@p0` `@ P(P@]X e`mQğd `00h R tpP@p#TpP P0X}`pPf P` \P`P $P@ "PP^ ßU @v@>Vpp>V<V)`TV%`0FV ^ W@ >P00 |P00 &P00 yV00FtD#00`@0n~P\0P@`0`d`)P ])``yPP@Q(P" Mp,p.#P@ps tsi`12V 0R 0+0@xQ0 00 @   0L P0S 0B @CP@z1` \ pEqP*PO[<P9 >P00 &PF }$(qpZ `b$(1@@`{0C0 ^0 00 `@0` @h(}P @ p` 3P@P,P@-P 0 0:7 2  XW   TW HW LQLa P P@ p #P \P P$ !@@\@ @ P p`p@ T `PP @fT0x K 0Ѝ@@H`00` P0@f 2,W ` PPJ @`T P 0S 0SLP @X/T@@X     8pP p  `V10]P(0  P0 PP 0 \Q" a QQ|0   @  45pW gs FP-Ns P \   Q` 0000 ~X 0 p` p,  |W @U U P O-PMp!P hdd0PW H!A0 0PP ЍP. 0S S S`v  `VZ @[ |d0 h`TL0 0p `! \W 8p`HO-hMP"XQ0@TLq`&P  0\ @|T "P P Ѝ0P0| S* `V Pp @ pP =PR@TZ DD \< X`V Z:`Y   \ \W |E-0MSp 0St!00PU. ` 0 0R PE @P( V `PU @Q0S 4 R @0P Ѝx pWV! P  U  U ` p@-00P+@[h PP` 0 Sp@V00U00PU00``\00  P P 0 S p@>U Y A-4nMgύ@  02 !APS  #1PU) p PU  T02  $ P `=V V6/snPUA1g_0 QP0S0   nߍ X M`0PPP @x0@|`@B0 0  FPEY W U Y U pW tW xW O-  0R4 5(*!0\T0H @00R P@45'*H\  0R0304 5*pj H\pWp P_ _  ^ 4 _ $$ 0Q/ 0_ _ _ 0@-4P4@M 0RQЍ0_ _ p@-PPP`0@T @ o Bldp@p _ _ _ ,0- MRЍЍ_ 0P@-p@s` H R 0^01045*$a@. A-PPPppp0MW U Ѝ ! M`@ 0TTU@ l@Xa\ \0PdDaT@p] _ 4 _ _ _ p @-X@0L    0$@Xl] ^ p -M0`0 R T H\ 0\01045*ЍЍЍR^  Kp@-@_ _`Q P@<P\000@0@Q  pO-M MP  @Tu _ Rg O0ScڰX P@|_@UPXh `P` ` ``Q`kVp,p<ZXPp@ X p!@ ZPZ0f ,pV ,p R^ 5_P 2_`~`0 Re4V ߍۍ  b㓾 }P@8 PC84 AJ| ! ^~\P0@x:`[`@PE\ \\ 8p0G  `` @PE\4tWP C^ "W'WQ Q< 0pW4P j |R ΍0t&R2 ⪞^ ΍1x&R00&R;RtVUPPSy <\>\ U a@AQ 8 B ΍0t&R4P0 ``Qt6S `SQ t6S `S0`RD  0RQ`F`Qt6S4P0! 8``F@(S  (S{S@dA R ps0 n@^ t6S0^9X  W01 PX  W0& 0t6)S}S  R LlAQ  HpG88@ 2. Q0xY4P PP  SP1SU0 40 >Q Q Q00 Q<QY00S cQPdU   \ R&J0Qt6<S S &S  B>Qr0 t6<S S |S>SLbA 8@  4"P'PPP   "Q'Q  /\P<~S/S ΍!x\0089͵80C P P \P00cƟP  PE R@UV PE R U eژv`p A XpW @xT 0P0`@ P@Q$W<] [|R>\d Q fa AK N80L G`FeAQ =8L 84PddQpE`P` P PU {PZ %p0S 5P $Q4H@TD 0\03045%*@P  4F`F\ `R@Pp dğ^ufP l1 RhQf0SyC )0Sß"#00gkjAf  8 B@ 4$ /\3倣PP太 N@ O>`k`oHJ媮00( P$f $O@P` L\P P.^mPj /R\0S?NpfP9 ^  Hʝ*  RO Y+ cYP Y2QH H I P R 1TJQ  B   0(_[ @(Q $@P$L R  Q p n(0 S0| ?@\pP0 @n 0)x %2`L@[t@d8x7 P`ppet] x] _ 4  _ _  xPiP_ _ $_ _ CN pQ@xpurY6\ @T2 0S/ :SQ*  P\ :P PZZ: Pd 0  0 dS   `Q.ª΍ 0 ` (0M0@-0PM @Tp H@T 0\01045 *Ѝ0Z|^ ^  O-_/OM4M_`:`(`/``pf @K  @```V88`00  | $pCZ@JXP>j0pF[ p0 -pZZ %]Y000z$P`V  -`.@ `p`\W$@:$S$ pT ʍ `0S-Y 0ܝ c}/` SVP6*/L~P(hTtDhPhhhhhPhhhh hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhpW^ @!PG$@WU'hh|hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh0thhhhhhhhhhhhhhhhhhhhhhhhhht/ \ 0ʍ(0(:/ 0`0)ɟ 0R0ڈyY@>T Xd)0V L V4Ѝڍ*/(@T  /:/(ȟ00>/9\8l /E`P |HtH R\ 8 Yǟ'/yG0Sw  ǟ0 c /fW^G _oP 0R  R ]^  /E TP:/O\[\| 1LPQ L?QXP(\\5QʈEU @Q  d⥽:/l*//Hş/ꆽ<ş@P W$U$WH5@ g``\/ğHP  R:*/ \0A:Zt$ 0 Z* `XTJ`V `@y Wj ¿P": `.QP@* ``e `paY][Y[]@C WP`V* `N  ` ᵾPG R/RC0@W P:" `%;* 0Z`A0 ~0ʍ `0穼Z `,Z `) $@0ppGP*P  P 0gU$@ʍU @$ *0 p00 ѽp-0Z?p 0 / ܽ`PP`: ``` `PU: `#p `ʍ$ HSP+$ ~Rw !0/0HP$  P8*  /@ @T>@ !SP/yG@`/:/@Pʬ H\  0R:㴿 /*/b /^ _ _ _ ^ l] _ h_ p |^ |] ( _ x _ , 0 _ $_  p_ ^ P:/h @J/b/( /VPEAʍ ? @ ``EA-PM@p`T"PcP nP *42 R P`1F0S `pW Ps xl ifc ᵾv  㯾t` p* ݽ *㢾PAPPX^* :A@<T JA Q `` 0@C `` ` $0`D Pg>P:PK R ,L N Hx 8-M D @姽2h0@-p M P0 Ѝ0@;Q@ Q PЍ0x G-Mp`- M p";P6sP tP pP J @2 Q("P0S.SS@  P.PP@QPk_ Pc. ြ!V `XPKPA`ppX@ @U`UWPp ս 0 0`P Q@45*t /0 TUࠃ^ @PH@T.@ꖻ@U  d Lt8ݍ  4߼(@ @ X    H-M0 r ̻P8 (_ -M0_ p@-PM P00ڎ8廼P00$T@P "p 夻Ѝpaֻ ᥻Qpi *㞺QPd  {pV P00@@xQx p, P 0\. T+ 8 T@PT@P0T ڼp Q P мpr 0\0S  㿼p ~lZd[XXPUHR@Ok0_ 8 (_ GENAp< @ HL p(@-@  q`0 P TPR@0 ("Ġ< "? u  u  O-M^Tx1@t epS `P p` 0S'V  0 *  Gp7 ЍS @ cκ`P0d00׹`b p j 㾺@P g@j D  @0 D 4嵹@@ LL  d  8-p@-1BMM @ PA΍@@0 5@PR08d D1[9@P *;fC $č PPXD(Ѝۍp@Ѝ/C^ P@B^ 0 $T効 L ,x9CN 0@PhP  $40<勻C $č噹` | d H XA-PMp) D"Q 0S ` V Q"\ @T  ^ \Q1 \/ 0!坸XSP P `ʺό@`@p@T% d!Q Ѝ Q :R :\0 S00`p!0n^(  +P~& +0 @pX븀0S ݸ @ @@S p0p XX $0piq X  x` ` p`  `  u t @-$@. 0SP@ x p@-P@T p@ٷ` \0p#  VP @PLP@ h.dPp p賺^ 4!p("K$ K Kd  GENA  O-ąĥQMP M`p%йP^C0@+SQDP`P xP4% ż$@@Q똴:厺@P `|p4hꏻS< P4d@4pW4  ع.kP00㼸U Ҹϸ̸ɸSŸ¸㿸0P ݸJN PJn  @9\l ẚ˸ ѷPQ LPmP\0S:.9P Br`p `@0 @0S0Q.`Q   0@嗷Pl pP P[ 0+㫶P^ \(2J2 @11*\C BnZ?*p P `<\W%p 0P P "0PB0@Q @ P\ V:@  T: \ 00  ~\000^  @,` P `@  T::@Tw II|IxItI`P\Ix   ` ` | u  ` ` t 8d x pH@-`@`岶0s P凷 p 0 0|  @諶 d  -M.Y˷d E-jMP@`p!PnP sPE cPJ ( 0 N!Ppʘ1 UWX  P Ÿ`PU"\q@ P U) PH\:  0RP4 57*@V U HP1  \ 03045: Ѝ *7jN`p<Q 0@A T  0A PPh >Q@@A ; oPO @   O-yM@@ 㗷X`V Z X;EPY㌕ 㕷@PmF 'PT0夠娐[㬀p@ZDYHXLWXqZF sRZ 0GSaQ`|P@帑 |倰 pt\RW 01SD`ᴑ弱p 0@xJRT 0SŠ6 @PpQ 4S 4 S`p@AQa@@xPPD崑弱It`|唠`p!HL1XßRd!  `p$0(l1|HL xPT|X0\)t x0`0480`A,<@!d 0 Dh吴yߍF, yPf G::Ҷ@P<GTB PPQ# pP$0H!@SW0 S/ S1 SP Sx dLX1`VP AT 6PYAĠ 6PBA4 6P&eS+ hST dS TPD!`PP      _ ۴ ִ Ѵ  ̴ Ǵ ´ 彴 ᷴx" u H mB.A@@@U(R x   X h P 8808 R / 0Q/ 8$($ $$1 USQ  /U0U 1!/!\PUBŸ`p @~PU R`V @0ZP埮}A @Q000) ΰVn !I  έP00 0TPI( ⾭PP0P0 Q[ ,­WV V V S 0嘰4:8|`0 ㍰㩰Fw  }  } } u u  } } d ` h \ } T X r  x P L }  *)@ p ))')&} X)()0'X''0@-@ M0Zx0x @ 01P@@P P@P0 RЍ0@ h* u } p 0@-MPG@02 0­P P 0 #  3PЍ0PP L 000P0@00 p  } x (u  +0@-0PM@WP 0 Ѝ0p } O-,M  Q0P@ ` GSd0P [`` [`3V `D0<#@@@$@,3P  00`@ T -T +T-T֯뼂$0 CA*\ 4l`lxQ0  [nX2  Q030#Q0SEx=Y MPd!dq` u'@P0MKPAPOPP6G  FL9-T-T+Ts J 0  0 ,Ѝ `0T @@K@$@8$0u ,u } 0+p x  } } h+  ʚ;P++@-` @M0T@@ 4  0(S ЍB+} + A-`QtPp@0 PS P W p@VW,ȫAbp} ++A-`QtPp@0 PS YPW p@VW,墫A<p} + , -餩LUMpI` Q0YB c xɟ cTh XA l rd  Q dhP0)0ɟK^ @P0g ɟ@) 0E@Pd~K0pW XpWڼȟ` @P 0 L !0W `j0KK\(k\ (HpW(^K` K 0 h P d1P R@ 4 0Y< ȟ W . Q@ TK7 @ @d'PP 4K0`aV@Wd1@A_@ R W 0AYFB ^K00 0  \2\A0" ~K nKƪxF^Z V @nKP 0|K 0@wK K?K00v0`pS- \ L1X0 0 ~Ka4QXh!RڨUE P 0@@TPQA) \\)P@P 1 Sʍ \  ! S0Sʈ  0K 1 S0Sʀ  0K\  0 Y{ T@TKKK0@H ?K OT\AP $v 0VKK \A0 1 @`pP 0OJ-K NK0FJ7H YR\Q@ @^%Y<9  \ 4!@4!@044TIK0F0^ @0P\A.KK  ~l ‚!0PPhAED 3>KX8QXP \Q PQ U0 } @   } } } p  ,x ,, ,@,@-@M`0pSRʀ R hnCoπ 000 0 0!@Ѝ@[` }  -ELLM \ 0 c c` @P` ypePU X հp0@ Xp 0Lş2 ` @0S0p SS0p S0p 0&0 `@めZʻ 0pP? 4L @PDKDKAK `5#@P@P 0$K V*DğD`0S88 0 0۩$L\ 4`$K 0  ɩ#<`  V00\~   #K @ ᴩ` X 00`Pa@\X@ &`a@QA> 0 R<V   (;`  S+ X`@Q0 @dX 0 PʨR\0p Qʼb ;BR"0 X PoX Rp\(KPRP @ @R QʺP 0S*PU@0@p< PU*8Q}}qRD@Ep0C ?%KQPX@P"0X0 PUQPD徧!QX@"0X0 P ` 0R 0@P T$ P埧圧 @QP 吧\ 0 <0p ި$ TQ } } }  -} -.H.p -@ x../.h-8-O-LMCTBP4 3ß`^ 0400404`|#|V4p4pH` R%Pc pZ @P  s`[V p0W@ P@PQ pW LЍ Rȟ Q* C@P 0 G 0 G@ @"PDP`A,2PP0"@(2(@@@tPBPEA4@D@0`!P` @ R , R? * , `VC @1@Pp0pB0@  0 0`pP 0|G@@^ P+PD, caP@墦  Dd UtTrWt LЍO1`pP 0 0 X Q!%0@@!<p@@m} x X/ / }  P<###4u   ##0@-1M}PP !Q妨P3@P'巩Ѝ0` PPt@d0\_ P P  Ptȟt pT(`VLh Dh0c^ 4ʥW5 b[s(HP) 0^ 03045%* a@Q/-,,.L.@-@-@-@-0-@-@-4-D-L---l.@-,,./00\'\gT1`a@GQ @@|V{mP  R QPT;P6 l_=PVx2@P0SS S 0S00@&0^ ,&ş(7wƟPqoş Z&ȥpb 倂Y8 ue @`0LSlS| 0P P@ 000 @W C0B Tm TT] T[ 0SS0 S00R TY$ 0 9ğP PP $P 0s3Ut#4,$(pH`[0h0W0h0tV0h0X*崃P`` PQ!h@T xPx<  O P  0Jv 㾦 o凤Xt僤p偤I]㞤ɣPPX㖤#I͠忣PP@M^7e륥ヤQŸ  ;{`p_ˏd 'PG G>F G>P媥PQ0  P0S2 @@0 9"00 `v@U@ᕣ s|Q@ @D 2!1噣eP ]GpP" PP lP  93 gP*'8yP:٣QPΣP  1 1P T X   u  1}   2L  D }  p H3 } 2} x } 84X5H 5`455 7 2H2``2x226333/36453(0@ R N( l @-\pM0SL`LP@D!Ԣ@PT Ѝ/Ѝ@蛢d T  =81p@-@PT2 Q"U ᴢaA0Q045*s0 YP( NP" P P 嚣 H\D0 gU p裣0 [`P pUD PP4pU   (=8=p  P 8Xq0@-@MPP 0P:t R00SЍ0TUqLRHP 00Cꨦ , H===h=E-M`P@Pq 0 R0 c!0 Rà 0 P @ Ѝ2KP@#`\<P 0a 0 (` =====>L 0@-@MPP |0Sp R00SЍ0PӡHСDP0000¡ꨦ , H===h=E-M`P@Pq 0 R0 c!0 Rà 0 P @ Ѝ蕡咡P000@0ꆡ`僡\P 0a 0 (` =====>L -M'pHp@-l`M@_M 0 判T8 + PЍۍpUh >G-P 5M+㠐@P ЍGs 0a`Tp` %ATġ+ a@ ЍU+̢ Ph (>XP X> @-M0^@1A@+0, Pd H+D PH Ѝ@Q+8 PЍ訦 P h x>>@-P M` 0P: R00Sh Ѝp5@P 0T \J+ P @嫠8J  Uꨦ , >P h ? ?X@-0 M0WpP Ѝ@M8@`[@JTP Dh @-0 M0;pP Ѝ@18@`[@TP Dh @-P M 0 P Q Ѝ`4P@`@: S S S(@@PPU@4|8pp<`ppP PH@`[@UP DGꨦ \ X L h @-0 M0YpP Ѝ@8@`[@LTP D'h @-P M 0 P Q Ѝ`2P `@: S S S@@PP"U@pp`ppP PH@`[@UP Dꨦ \ X L h &O-MMQ@0A0* R C6Q:Q (P@@TLDT:tA8(PJnN$$&p P=^PE?0  l@V3{5' p`W VP{E^nV, E0U(Ex%0#@@B\p1S : S&  S2  S5  S8 S;  S  S V6@XL T ᯡP& Dǟ 0S T 0 ^ \-  ^ ݞ: S @ğ0 RWЍۍ$$$ ʠT  PP`t @@GP`lPa@`e@W`Lp<^PGhDp&Ƞ   R L TzA^@E t&3+  B pQf΍PLdK  3 l@V# T P /pŸjPA4(`?! |@W 0Ÿ  0 S0211  @ ' 0Ws  ^E: SEB k gc\8TTמP R @iP 01:1 : S 0060  j 00 00X H? d L h j H \ ?Pi @P  T  x???`H@@ @p@?X ?4 X?0 8 < D ,&O-MMQ 0A0* R `5Q[:Q ൟ*5S@C T*pAn`Fpo! PX|c ktt%& `ಀV XP@E^X, 45@U((E$%0" @B\p1S 0: S   S  S  S S  S  S f@ZL T tߟP) t`\4  P| T t^,00^ \Z* R 60 Q @ß0  RgЍۍ hPB4lDˍ  ) p QkAN↋@D[   8PSW #SP@ PL2 $PPJ PPFlP^LBCʌ"| 筞:T dQP Pi$Ÿ00t0"  疞qŸ 00!0 QIN 0B 0>  0喜* RW10 QWTT僜L"H R0 0P 0'! d0  00 00 X H? d L h j H \ ?Pi @P  x? ??T `H@@ @p@?X ?4 @0 8 < D O-EM Mi6oP @b6PUppppp_pp/p?P`@pP  0-SA ^` @Pϟ>.pΟ@N^`P @Pe ἞P_ YP%@PpN:pś〜P |PL]㼞0 00S a CRR@R@R@R@RQ@R@R@R@R@RRR@R@R@R@RRR@R@RR-=` x͟倽mpP@۟@PpP@`ᕝ Q{}ǝ͟P@@KT}+0啞 P L+ P !M p?@R N=R( ͠(0R1 8 R*P͟P=PM  @ ^ @T-@T  n0S˟  1Pu [`V^;@T&dY5PH,T58 4h ` 0  PLl@   KY 65505;Q)5P*e 卜Vh[ f0\˟E ၜT [lk Q`  P[E pP X J(P`Q 6 0@T  B  :@T6 j( `BQP@0Pe @TPHY\1HIQ <9`V|YڜA΍@ P(A  Ɵ0S  ܛPx ` P QE<` Qi:$FPAX L&0S\ şP0\ 5 QŠ5 U@00Q S "QZ P T5L@  LHP / 0@PaV@@!T0p.lfP /V@!P 0aÂtT@P$\00Sd0#c 0\#\ Q \0# @QR Q0 cQ0UCP 0`cd4 4٘ß#@P1 SP^00S^d0@e@ed04 巘 2RbŸ@0P`@``@| ` @埘|"\Q!\\Ѝۍx!\ l1P! QPvPx 1` 2!0 @!PJ@QbE@P!\00SW\0 c 0\#\ Q^ \0  6@T   $    @`@@@A PA DB\ ` xBBBBP `l ( xC DXD@CCD B;P;;;4 @ H 0 8 < D ;pDDC=L $ BAAA h p< <<<BCC0C@CPChCpA  , X @ HB  A|PؗP 0` 2!0 @!PnP 1 ఄ@8岗<P; P!0ంC4QH Ep@T!P $嗗*n'`$X|A||1 L KvP1E ϘTR  E ØT ,"\\ B.2%@ᲘP lp@@6TMp\FP@`V .3` 0 4@/ , )%EP(S44C4  N `h3hh@ D@ 2E pW/궗P 㲗P3#Qy9T :O-霑圱圁圡0 M`p0 p! @P` PL PhUeT fT0 nT sT! vT0!0@P1 R5  ЍOE!1  11@#1P A@P 0\#\ Θ̚$0  E  EEE `Dp@-0MP帘@P1`0 ,000 00000 0$0(0>P)$幙U@0Ѝp厖| Pl뚙֗U@  D됙<じ@P,)녙)E p$(F0FEEFp@-ŸB2RM@"&/@PP] 0@`L$?_@@ ,Qd 0܍p0000 P@$@7@PrUe  引Pf91!<a 0b0L⊖P ` )\\5`PP  P2 0P P@!Q0 AA AP @0P L  FPP˗kⳗc0< `BvPh㿗@PX(뷙P(L(G8F h PFFE p$@ t FXF`x xFEEFF@-` M@Pp }p dP oP p0i(`W Vt0 Ta&p3 Ѝ@0T!0p# o&PpG  P-`X0CPP 0 c0!0R#\00S 0@-P0@MT*T#  Q 00 c0!0R# Q00SQ00S 4 Ѝ0  GxG0@- ?MP@PߗQ \PPPЍ0d@- \@\RX0T0  0RC㴕(\ @~긪 Ȫ (n Gp @-lp M@_ 0`ᤗT 4U+㺕 P Ѝ ?GO-`PBMMJ@P 0S p -S ϟX _ RA<m`VJP 0SP@T DPU R,pWn Y//==(08000+@P 嗖P# P)nΟ~@.`:`P|P `l}E.P(N * P @ X >` N+m,㰠Xᰡ  ͟Z0-s 㪠X000NZ 01X%zFᰰ@ᴰ`p X /0 @c->pX /@P à>T00W00S? WX p/0`` - Ll-̟%孕P%ᨕ|@pgPopBpQ.0`Pb5!`PQT00SP pgQ0 !PT &/}-H`x+0`S /%d@ ʟJ4 ^PpP .`0   ˠ  @T \ k" d-j@A]8 eʟxpP0 npᐓP Q( Ғ @T! @0Pp @. Q 9@ A00`H$QL- `yRPp9PUڬ)`I`p0 cpBpQ000a UADP 0P嶕@Y,ϓ P+0@娕 PV W.00S( c CR/wwwwwwxww\xwtxwwwwwwwx㣔pPeIAm8 5P`Pfᰕ xp`Q@@DVhPPWP0S \ X= A< ǟ|Y`V  pW! A <ZՒ|0 RPx&M=?00 P\NpP<p$6 `V `V `P$PE 0 P PE `VZx/*x~@ @8PCRP5P갠e岠 `hUh%0Ppp  Q  @A<@!Ƞ\ PU@ d pP` P5 % d@PP_PP @T`wA +㡓@D@ TM PIPPX  Z @@ 0DZ0p P P0 0^  ppYD#@ T00SJ%@0@WS@P P `mQ i Pj u `W_0DE WTRr \ "!B%@HPЍڍ,:0B0r 00FbQ\xq 꿐 8a @`p@'2  UPPPPP pW@4p +@@ Tl  PPPW  X  Qi `PQ`#*P  `lp 0p姓T Q0+Q %X2E k꼪   @`  H Ī BCC0CHHC@I I@H(nHGPIHxGhHH(HHJ Ъ H Ȫ ̪ III>I`I<끾8 f` 0p + p[@ PPP @ T` V#@ᾡ0A B` ~ p +㷀6@PPP @ T` V`9d7lU#t1|.,Uf1%劑@P ! P iD pV@@ 0T:ac0pQa R @@{ $(,00#1 01/00 R/0  00 0/ 0@- ?MP@P岒Q /PPPЍ0O-|MP@ݏ봦崖v) 契0`0&X ?^࠱NEt~+tP`FPV -R0fS vS cS 셟 IşU@TY |PFIm p PpP@^p?^࠱I+pPepP^P  +U  R(uq Q4P U Q01PCQ܄E؄P PZ U4   @T 4 R< !)@P0T*XQ\ U` 00US pP2P @ T0p`PP`EW *@P pW:*pTs 0P`e FRPl`0XC^P L  R`pkp@0 K婑PR9 @Q  PPPU Q! B L R l1Ft"@y PD/M!` W pW"jxtpl   H KKKKJJHPJHKXKJ(J8KJxK K8LL 0  O-MpPP$Xp pP4YD 0 $ᝐ⣎ğ|x Nx|XHx[K|P`P``HZ  R4 5I*z PG ZP( H\! 0P45: ҐHZ z ᖏ; 0CP p:%  W0|@00U \)P U0````VPվ +"pY D0S Rd]*@Pw* 0.+Y8 * 0h H`VA pQp45>*H R3 0\ 030457*X J H`V 0 \01045:MX ZHP  `R 0304 5*qWx`Q PTꁏ ~ {Qp帍p $ !#P2 寏P`@  0P  0 Pݏ-|%p"dw@^tZЍ8& p `HLXLp  8 `HX0-MH R  P 03045*B ď> : @-PMp`"'@'@&Ѝ@舍E-PPMp1 ࠟ,^`P00P@' P$ P @ 00|Pp0   T0^ V ,PPVPЍ@NXMt PO-M@@PT`8481 RpP1   0H@P T$ U 뺎 R@ 벎 R   0*@P HR\Q Ѝ pP   0P X P $`t mPBPؖ崱, 唍!PP< 8V哎`PDPDPPEPE4  wP A0*S)0C40 #S Sc HƟ0  [ 0S00%P <8(8$ HP % ( Xkm/SO KG< 8(18 $ Y Z00S ḌZT ,oߍ墌P00,0 0j@P Z" X P P!R H$E$봱:ᰱ婍PAM PP㬑m/k +%$" P U `6% P0nS U ߋP ,QQ 0S P  P,R P00 S PP,\ DP * ! X$!$Z4 0R0Y0S[ $` tP A \Y Y< 8$(8 P +Y3$ 9,,݋[pPa ᦌPP @CP >P4 Y5 ` 6P  0`娉ሌPPᣌQ!k m/uo$l%0 *} R뜐崱,Po`@` ԊPnQToR 5)Y o\%8P  pL LL`x LLLMMbzzLL 8ML-M▊PЍ- M@0PЍ0@- M@PP 0 @@dP Ѝ00@-MP@P  0S  P Ѝ0-+MhPЍ0@-MP@ဋP 0S P Ѝ0-PM`  T S 0 s ((呋 Ѝ1Ѝ SXR O-0OMMP QU `j# P:P` @$`jv $^ 0 $ju ߍۍG x :@Pg P P,؋P P,^0 P L ;᷊P  "@P  Rp⪞ ͊`堎pV`[#@X#  R*p]p@\00` p"j/⒊ <P0XX(帨9尨:PP ̟L',0X`@TP0(,48<@DHL\ PPP =h@P0 p9`h坊Ph T嗊Ph @告Ph ,勊Ph 兊Ph Ph yPth 㷉PP@@jP4@ dPt34XωPP80TSP0 <@D PH0K\R  S 00@ \(TQ@00\U\00 Sz\\00St\ Z Q^ Z\(RT^0F080pȍ q 4@p3T \X $*QT PPPQ @LjppIP 9P00՝@)Nb\@@P@T00pPpŌL@(T<00\800 S 'X`TPP(P,P4P⭆pU dhp 0gx@PhK ,PhhhhA^  ^NQR~ APUBPX("4<" T o ̍R00 `ֆP(B"4<"  L A;CPʫ΍ CP΍N tX嵆#=, $ $  剉j@l +j/㚆dhD ^R/  QP 4, l^ LPjʍ0 塈P$F @J/0$*]S0JJJJJJJJJf $CZ$0@P >|# 0Pb^`!`3V :Sc J 0 , P @X %l%̆Q`ju Q h^ Q40S dhZ  P`l"V@$@PL`P @$`FhP<@P TP@@J @P0t03D0A$j*H   EXo\ $KP @B x8|8888888勇ʝY/A[N ʅ08T0S APUDӅP @pP7 KT l l l`V@l@Ň PJc* @Y/ 㠅^ PDDˠ 00| RRPOOOOOOOOQ Qx RQ (QpOS0QHOPxXQ8Q@QQR RS0RHRPP P0P@PHQHPXPhPpPxPPHPPP= PPPQxPQ^0P ʍP{P$ j L("d<"ԅ  PP<@dT%Uh`V  R$ @$P  jP't @$p @ @PP`B P< P,`6 P()׆P t 3H 0ΆPX` DȆP\` X†P`` l弆P|嵆PT@宆P 婆P PT  PT 峄咆P@t@3劆P PUi<垄H}PT\@t@3L@tpP  `P @$`"倄T փP$P @P-PM0PЍ6T@-hM @P#: S Q IP hhЍ:D0@4 R( 0Q  HSS0p@- hMfQ0  P -^``P aP ʇ`hЍp ᗃPxx{PP` E@P TPP`8@Pq  L`LS P/P 0/0A-P`U p᷅P@1Xl @ᭅP P娅P 墅P PU@ @ zzp@-2M@`P> ኅP# Ņ 1P RU PU Q^P&Ѝp 㯄P1@Ӆ0SG8 PNP LኅP( $ S(TTHTG-PMM`P^Br`V#  0-S0 0S a0CSB0PPPP8PPPPP@PPPPPHPPPPZ R@p@D#nP \P0p`FVPЍڍ壆Pj`P&PP p,P PPW &@P,\( P2@B0  p-P  a@@=@ pP %,kp0$2  HxTTb`hT0@-M@P2/P  P  Ѝ0ۄ0S C T H0@-m/ M0P@0 mPLm!gP Z P Ѝ0  T R 0-S C0SrP 0 0/ p --M0 0PЍ Ѝ/T@-`MpPH0S  R@4 5*t T U lPYTyTpH0PES@tЍ{@ - MSP00Ѝp@-`PP@ #HP σ0P8ppp0@-p PPP@M/-0/S/P @(\ 0 0@ Ѝ0PuTO-M`Mp,PM'Pp  RL : Se  S  S S  S  S SY : ҂PO@@: S S@@>  S<  S S  P ځPP 4pP ,00Ѝt 0Qh\ l0R  )P  YX   ^ pP00 ၂P@  PP B@ _PgP@ ƒY7 y 㿂pP Yw Nᴂp@  pƒPᾃP 00R ܁ 0 ᥃P Ё 0 LP  5Q YፁP2X}00OHHBH 0f{@Pw@A6< P0Pfy!. VA >p@IP@B |;0; 庀PH1@/ េP &   _00  5dt  <PVHT(VUhUT@V UVHUUVxVUUUT(UXVE-PM&R PP`pT `U:U* f0 @P  X`ÛV Ѝ`ÂὂVh 0-@@P0/0@-XP  @P낂0Sg VPHI 08 0  \0000 0P \ P~P#: S S  S c W  R0`p `0T   V   ` W H -O-@-0LMT0 P딍@PTp [ 0S @@PPpW `V R%R  0 R%RR \@+ @ ePP@pcT`- lT\ XP Pp 00P|<0P  `P  \@ LP8 9P.UP@U cTp`pP0S `00@ 0T@jP PZ%Z `PU%U00W:`X PUy0 Pp0 Ph  p 0 g ~P ~pP*@`0 P@@Pph{pQ- Y80,*@L:`pPU> 0S0S0 R ᷀ 00 RS0U@[ q ɟ@ PT p堉ɟ ? 0 @8)@h0S? \iPTH98 r  T ,Y0L~PI )00|8 `@Tx@TT hP {`PTo @ t 0 S( T~ TPU ,08 {Pn X  #~0ǟ ? 0 Q_ 70APUz  Y\ pX XO PUJ 0, ^)  ;0S" `@s@`%\  %Q`@Q0S ~P0 0S0@XU 0 SG 5S \S S X8 @P ? 0U pXY  PUş@ PT 0 5% S7 @S SF{XQ   RR Rh R5{P0 000 Sk  S'{S S R R0}#{PiP @0@@ x00{0 SS ^X @@*&@l } s00ziF|zb@TQ:'Pz|P7<|<zJ czCz? RF|z5@3 @.z+ s<@z  z 6{BP s  z @||@@ 0zpŸ0DS00U {\ L  0 @T  S @T 0SXzŸLЍQz R @ RsT _T0pcSD !AS1 aS4 P RQ b` 0 0W Wp;pS# uS̠  b`@p@)0  0dSoS xSp0@``0@c@@ (X8X9X`W0W)X(WPhWx     WXW@XP H| WRWpW-- M  P H0S 0\01045* ЍЍ/6}| -M a\0H R P 03045*0| }| a|| l G-hM@ yP  PhЍ: S. {P R|PP  {P  @{P  yP  R yPQ^ m{$\b`A-pP`L @P , {P0P`1; @Pp ,W@-MD EyPJ: S: ${PP: {P  @.R.\0 {P h@$yPx0 Q v|zP?|d@Ѝ R\1|T8bG{PP0< ^ 5 uXxmzYX@-@RpMP ` @T`  PPЍ@-@RpMP `@T`  }PPЍ0@S /S R0S0/S  /E-pMP` R@4 5**t0H VT T@` H0S{@t0HW yPЍPT Tp@`Z`F_y@{p0@- M P@ y 0ST  Ѝ05/@- M@p`x x xP00P0 P0P00͑0SP00͑V00W00 ЍYO-0dM 0Q0   000 00P 2*  @ @ @R@PPddP`@pP`@ Y<Ÿ&0  p bWx> 쑟졟p@`pP@ Y'0  0` bVx< xx`@p@`P YT$0, 0p W bx< pP@`Pp@ Y0  ` b0Vs 0 0P 000e 0 dЍ1YtY YAYY$YQYY(YaY4Z,YO-R`M@pPI@c7/T Z 1 !Y0P 8t 7/[)Pp@U0@@007Uxpe8pe By 000@ 1 0 P  hzЍCAm(IN 0 mPDTYZQW04T ^<04͵N0 044k@%@4T)  H$n,n@P   0mP @N΍4Q S0 Q 0 0— R 00 R }mm  @n@ Ѝۍ\mPJL R CA   ` c0cc @cO-RM@pPᨠ   @:Q@5 T3 Rx RPsR  R 0R:R ~R-R@ *RQ T -T 0S S< S8 0S R:R00C0 Q(p0  fP:0P  S0  S,  0P P`q^PQ0  0p pp R:R0 R:R@<(wjPߍOЍ/ h  @0@  Q 0S -S  0S/Pi `H R 0 S 88//g@-@PM`PpU @PPЍ@gL, 0 / 0 /x P/.g Q 0.S {0S .S\/@-@jf0p03T0STh@-@g0p03T0STh0@-M@Pf0p03T0S UЍ0Th-0PM gP Ѝ0Th0@-PPM @ Ѝ0@[i@-@hP H/@- @gp H-Mgp Ѝip@-@R`PP P @Tpp- M  Ѝ@-@fPvH 0 p hi-$0MfPЍp hi>h--M0 0Ѝ Ѝ/--(0 M  ЍЍ/p O-@ Mp-P0 ePP 7ig `Pe0pSPT X P @P KgP@WPP WQ# W Ѝ- M! 1v Ѝ0  @- M@ !00Ѝ@- M@`gPpe0S0PVp Ѝ@- M@`rgP pe0S0 RVp Ѝ@- M@`WgP p*e0S0 RVp Ѝ-M  0@gl @-@gP0Ա00ıp@-@M`-PP 1 5 -R`PPQЍp0+S1hh- M Ѝ Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/-/@-@A/Q B aB Q' 00`BS&(   QQ11"1:QQ11 1:S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3/Q!! # 3 Q!! "Q!! "Q \3`B/-Q/@-@A/!1#0@-@P40 JZtPe@ 0!"# 0!6U0@/Ơ! p6#6 r04i @D uΠ2S PE RΠ#SQZ|Q:Q:`l@*rk*\0@/@D1040 R"(!0C" R"$!0C"R""!0C"R0C"0C01C S  b 1 b0@T0@/@@T @@ d010@/ @d d00@/10@/46#!@PE 40 0@/10@/ʰ#0@/E20@8/1Q0@/0 FV10@/0/0@-K2@P0/0@-K2@Q`B| a43!/23/0@-MQl /0@-P /0@-QZpK2@!˰D    ! 0bà01@7p@-̌!J#Z 4 5u @`!:VV6 ŽP!`S<@D VL*P` T \^p@/a!@T Ptp@/@T]6tp@/@d @T @ @ Pd50!1p@/ @d Pd40p@/ Pd04511p@/4a@D 5a 0PE 0 4#Z 5 ``!p@/`` 4f  5f!p@/>p@/p@-̌!J#Z 4 5^ @D!VL 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \CUVp@/!@ Ptp@/@T1/#Z 4 5 4F 5 5Vh ``H@tP^x  10/p1QQP!1/Ɛƒ /  0@-PpC@/-/-3#/-/-/-3#/ *& *Z>>*SJ51:3//// 2RS"|"!R/.&/* b b<055 320:6// ! 02BCG ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1 R:0",S413`//ar$//M`-!Ѝ /M`-Ѝ /@-b@/A-Mpy`0("@PU` 0`ЍA/A-Mp `0("@PU` 0`ЍA/O-\$M PQ@0P`p Pp S`rp  WPVBV*VV#35!4000 s @ 0b43BR@%  x'x ,8HT*@K*TK2@0@b  `8#8P*0`F*S`F2 VPU*UU#35!3000 s@e6  0k8C13[% r x'x@$8HT*@H*TH2@0@b \ ` 8#8P*`F*P`F20@d%B}x'x@ $8HT*@I*TI2@0@b,`g 8#8P*0`F*S`F2 qWlW*WW#31 1000 0s0XP!#W*T0 c52@d8B<"0&  +(@ $8HT\*@K*TK2@0@b  p8#8P*pG*P0pG2 b .Ƞ%8 8"H 8S  00TP N 0S p$ЍO/dO-M P@S0pP RBR*RR#35!4000 s 0b03rR %rx'x @ $8HT*@I*TI2@0@b\` 8#8P*0`F*S`F2 REPU*UU#35!3000 s@e6  0k7C13[{%p'bx'x@ $8HT*@I*TI2@0@b`L8#8P*`F*P`F20 @d %2x'x @ $8HT*@I*TI2@0@b` 8#8P*0`F*S`F2 qSlS*SS#31 1000 0s0 WR!#W*T0@ c52 d7B0"0&s p ( p'8HTP*@K*TK2@0@b  p@8#8P*pG*P0pG2 b .Ƞ%8 8"H 8S  P00TP N ЍO/ -Lapplet not found%s Usage: busybox [function] [arguments]... or: [function] [arguments]... BusyBox is a multi-call binary that combines many common Unix utilities into a single executable. Most people will create a link to busybox for each function they wish to use and BusyBox will act like whatever it was invoked as! Currently defined functions: %s%s,%s No help available. %s Usage: %s %s --helpbusyboxThis applet requires root priviledges![arashawkbasenamebunzip2bzcatcatchgrpchmodchownchrootchvtclearcpcpiocutdatedcdddeallocvtdfdirnamedmesgdudumpkmapechoegrepenvexprfalsefbsetfdiskfgrepfindfreefsck.minixgetkeygrepgunzipgzipheadhexdumphostnamehwclockidifconfigifdownifupinsmodipkillkillallklogdlnloadfontloadkmaploggerlognamelogreadlosetuplslsmodmd5summkdirmkfifomkfs.minixmknodmkswapmktempmodprobemoremountmvncnetstatnslookupodopenvtpingping6pivot_rootprintfpspwdreadlinkreniceresetrmrmdirrmmodrouterun-partssedseqshsleepsortstart-stop-daemonstringssttyswapoffswaponsyncsyslogdtailtarteetelnettesttftptoptouchtrtraceroutetruettyudhcpcudhcpdumountunameuniqunzipuptimeviwatchwcwgetwhichwhowhoamixargsyeszcat[-o] [-v] [-p] [-t] [-x] ARCHIVE FILES[OPTION]... [program-text] [FILE ...]FILE [SUFFIX][OPTION]... [FILE]FILE[-u] [FILE]...[OPTION]... GROUP FILE...[-R] MODE[,MODE]... FILE...[ -Rh ]... OWNER[<.|:>[GROUP]] FILE...NEWROOT [COMMAND...]N[OPTION]... SOURCE DEST-[dimtuv][F cpiofile][OPTION]... [FILE]...[OPTION]... [MMDDhhmm[[CC]YY][.ss]] [+FORMAT]expression ...[if=FILE] [of=FILE] [bs=N] [count=N] [skip=N] [seek=N] [conv=notrunc|noerror|sync][N][-hmk] [FILESYSTEM ...]FILENAME[-c] [-n LEVEL] [-s SIZE][-aHLdclsxhmk] [FILE]...> keymap[-neE] [ARG ...][-iu] [-] [name=value]... [command]EXPRESSION[options] [mode][-luv] [-C CYLINDERS] [-H HEADS] [-S SECTORS] [-b SSZ] DISK[PATH...] [EXPRESSION][-larvsmf] /dev/nametime [message][-ihHnqvs] PATTERN [FILEs...][OPTION]... FILE[OPTION]... [FILE]...[OPTION]... [FILE]...[-[bcdefnosvx]] [OPTION] FILE[OPTION] {hostname | -F FILE}[-r|--show] [-s|--hctosys] [-w|--systohc] [-l|--localtime] [-u|--utc][OPTIONS]... [USERNAME][-a] [

]<-ahinv> <-ahinv> [OPTION]... MODULE [symbol=value]...[ OPTIONS ] { address | link | route | tunnel } { COMMAND | help }[-signal] process-id [process-id ...][-q] [-signal] process-name [process-name ...][-c n] [-n][OPTION] TARGET... LINK_NAME|DIRECTORY< font< keymap[OPTION]... [MESSAGE][OPTION]...[OPTION]... LOOPDEVICE FILE or: losetup [OPTION]... -d LOOPDEVICE[-1AacCdeFilnpLrSsTtuvwxXhk] [filenames...][OPTION] [FILEs...][OPTION] DIRECTORY...[OPTIONS] name[-c | -l filename] [-nXX] [-iXX] /dev/name [blocks][OPTIONS] NAME TYPE MAJOR MINOR[-c] [-v0|-v1] device [block-count][-dq] TEMPLATE[-knqrsv] [MODULE ...][FILE ...][flags] DEVICE NODE [-o options,more-options][OPTION]... SOURCE DEST or: mv [OPTION]... SOURCE... DIRECTORY[OPTIONS] [IP] [port][-laenrtuwx][HOST] [SERVER][-aBbcDdeFfHhIiLlOovXx] [FILE] [ARGS...][OPTION]... host[OPTION]... hostNEW_ROOT PUT_OLDFORMAT [ARGUMENT...][-f] FILEpriority pid [pid ...][OPTION]... FILE...[OPTION]... DIRECTORY...[OPTION]... [MODULE]...[{add|del|delete}][-t] [-a ARG] [-u MASK] DIRECTORY[-efinr] pattern [files...][first [increment]] lastN[-n] [FILE]...[OPTIONS] [--start|--stop] ... [-- arguments...] [-afo] [-n length] [file ... ][-a|g] [-F DEVICE] [SETTING]...[OPTION] [DEVICE][OPTION] [DEVICE][OPTION]...[OPTION]... [FILE]...-[czjxtvO] [-f TARFILE] [-C DIR] [FILE(s)] ...[OPTION]... [FILE]...[-a] [-l USER] HOST [PORT]EXPRESSION or [ EXPRESSION ][OPTION]... HOST [PORT][OPTION]... COMMAND [ARGS...][-d ][-c] FILE [FILE ...][-cds] STRING1 [STRING2][-dnrv] [-m max_ttl] [-p port#] [-q nqueries] [-s src_addr] [-t tos] [-w wait] host [data size][-Cfbnqv] [-c CLIENTID] [-H HOSTNAME] [-i INTERFACE] [-p pidfile] [-r IP] [-s script][configfile] [flags] FILESYSTEM|DIRECTORY[OPTION]...[OPTION]... [INPUT [OUTPUT]][-opts[modifiers]] file[.zip] [list] [-x xlist] [-d exdir][OPTION] [FILE]...[-n ] COMMAND...[OPTION]... [FILE]...[-c|--continue] [-q|--quiet] [-O|--output-document file] [--header 'header: value'] [-Y|--proxy on/off] [-P DIR] url[COMMAND ...] [COMMAND] [OPTIONS] [ARGS...][OPTION]... [STRING]...FILE Q(Q0Qp8QL@QPPQP XQ`QQhQQpQRxQ@TQUQQdQVQXQ\Qd`QQeQQkQDnQQ(qQRrRRt R(R40R,8R)@RHR4PRXR PhRHpRxRRR<R,eRLRInvalid ar magic%s %d/%d%7d %s %s cfcompressed data not read from terminal. Use -f to force it..bz2Invalid extensionCouldn't remove %situvF:dmcftd-Couldn't stat file %s/dev/null.gz.tgzError inflatingInvalid magiccan't writecf123456789dqcompressed data not written to a terminal. Use -f to force compression.      Couldnt stat tar fileFailed to create gzip pipe/bin/gzip-fCould not exec gzip processFailed to vfork gzip processError exit delayed from previous errorsCouldnt wait ?-%sc~tx:t~cx:x~ct:X*:T*Cowardly refusing to create an empty archiveCouldnt chdir to %sCreating bzip2 compressed archives is not currently supported.%s: Not found in archive %0*lo%s: socket ignored%s: file is the archive; skippingRemoving leading '/' from member namesroot%s: Unknown file type%s: Cannot openustar txC:f:OpvkchjT:X:z%9u %02u-%02u-%02u %02u:%02u %s inflating: %s lnopqd:Archive: %s Length Date Time Name -------- ---- ---- ----Couldnt chdirInvlaide zip magicUnsupported compression method %d Invalid compressed data--crc errorInvalid compressed data--length error -------- -------%9d %d files Couldnt remove old fileCouldnt stat old file%s not created: newer or same age file existsCouldnt remove old file %sCouldnt create hard linkextract_archive: %sCannot create symlink from %s to '%s'Cannot create node %sUnrecognised file type%s %d/%d%10u %4u-%02u-%02u %02u:%02u:%02u %s -> %sShort readSeek failureInvalid ar headerlong filenames not supported /Data integrity error when decompressing.Compressed file ends unexpectedlyDecompression failedneed to fix this 07070Unsupported cpio format, use newc or crc%6c%8x%8x%8x%8x%8x%8lx%8lx%16c%8x%8x%8x%8cTRAILER!!!%d blocks %s not created: cannot resolve hardlinkerror resolving hardlink: did you create the archive with GNU cpio 2.0-2.2?Unknown compression method %dunexpected end of fileinflate_codes error 1inflate_codes error 2Incomplete literal treeincomplete distance treebad block type %d inflate error %dwritecrc errorIncorrect length #+3;CScscc !1Aa  0@`      ??ustarInvalid tar magicInvalid tar header checksumpax is not tarIgnoring GNU extension type %cUnknown typeflag: 0x%xInvalid gzip magicShort read, read %ld of %ldCan't create pipeFork failedRinvalid mode: %sRh/cannot change root directory to %sSHELL-icannot execute %spdRfiarPb~bcf:c~bcf:f~bcfyou must specify a list of bytes, characters, or fieldsonly one type of list may be specifiedHelp ntok is null for starting position! What do I do? invalid byte or field listmissing list of positionsthe delimiter must be a single charactersuppressing non-delimited lines makes sense only when operating on fieldsa delimiter may be specified only when operating on fieldsb:c:f:d:snd~ds:s~dsRs:ud:r:TZ=UTC0File '%s' not found. %d:%d:%d%d:%d%d.%d-%d:%d:%d%d.%d-%d:%d%d.%d.%d-%d:%d:%d%d.%d.%d-%d:%d%2d%2d%2d%2d%d%2dcannot set date%a, %d %b %Y %H:%M:%S GMT%a, %d %b %Y %H:%M:%S %z%a %b %e %H:%M:%S %Z %Y%f%Y.%m.%d-%H:%M:%Sbs=count=seek=skip=if=of=conv=notruncnoerrorinvalid conversion `%s'%ld+%ld records in %ld+%ld records out wkDMDMGD(cxy@y!y@Byyʚ;@%s: can't find mount point.rootfs/dev/root%-21s%9s %9s %9s %3ld%% %s h-km:k-hm:m-hkhmk Size1M-blocksFilesystem%11s%-15sUsed Available Use%% Mounted on 1k-blocks%s %s POSIXLY_CORRECTh-km:k-hm:m-hk:H-L:L-H:s-d:d-saHkLsxd:lchmtotalneEu*+iu:putenvignore-environmentunset@{iX{uwarning: unportable BRE: `%s': using `^' as the first character of a basic regular expression is not portable; it is being ignoredInvalid regular expressionnon-numeric argumentdivision by zero&quotesyntax errormatchindexsubstr(*+<<====!=>=>too few argumentsn: ==> %s <== %cid=%u%cid=%u(%s)u~g:g~urnug%u sfngetlogin|/@=###"##$# Cadil1gnsxAkcetuSXrvFpLhT:w: @` 0@!`P` %7ld %4lld %-10s %4ld %-8.8s %-8.8s%-8d %-8d%4d, %3d %9lld %24.24s %6.6s %5.5s %4.4s [%d;%dm -> %1c%s: %02x%s %s m:pinvalid mode `%s'parentsmppcub `non-cannot remove `%s'f-i:i-ffimv: overwrite `%s'? unable to rename `%s'interactiveforceifcannot overwrite %sdirectory with %sdirectory"%07.7_Ao ""%07.7_ao "" ""%07.7_ao " 8/2 "%06o " "\n"16/1 "%3_u " "\n"8/2 " %06o " "\n"16/1 "%03o " "\n"16/1 "%3_c " "\n"8/2 " %05u " "\n"4/4 " %010u " "\n"2/8 " %21.14e " "\n"4/4 " %14.7e " "\n"4/4 " %08x " "\n"8/2 " %04x " "\n"4/4 " %11d " "\n"8/2 " %6d " "\n"4/4 " %011o " "\n"aBbcDdeFfHhIiLlOoXxv  ؀ @Xp-+ #fiRrcannot remove `.' or `..'%g nruCOLUMNS%s = %s;min = %d; time = %d; rows %d; columns %d;%d %d min = %d; time = %d;only one device may be specifiedagF:verbose and stty-readable output styles are mutually exclusivemodes may not be set when specifying an output style%s: couldn't reset non-blocking modeinvalid argument `%s'missing argument to `%s'^-undefospeedrowscolscolumnssizespeed%lx:%lx:%lx:%lx%n:%x%n%s: unable to perform all requested operationsispeed%lx:%lx:%lx:%lx:%xparenbparoddcs5cs6cs7cs8hupclhupcstopbcreadclocalcrtsctsignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonixofftandemiuclcixanyimaxbelopostolcucocrnlonlcronocronlretofillofdelnl1nl0cr3cr2cr1cr0tab3tab2tab1tab0bs1bs0vt1vt0ff1ff0isigicanoniextenechoecrteraseechokechonlnoflshxcasetostopechoprtprteraseechoctlctlechoechokecrtkillintrquiteraseeol2startstopsusprprntweraselnextflushB%lu %lu ispeed %lu baud; ospeed %lu baud;%lu speed %lu baud;%s%s: no size information for this device000 00ȄЄ ؄@  (@08@HP X`h px @ȅЅ؅  @@@ (08@RHP ` h@px   8 @ H P X`h p x       ȆІR ؆     ȌЌ@!evenpparityoddpnleksanecookedrawpass8litoutcbreakdecctlqtabslcaseLCASEcrtdecswtchmintime eofeolreadno files@!fn:c:qs:v ==> %s <== wa%s: %s%s: out of range%s: bad numberargument expectedclosing paren expectedmissing ]unknown operand-r-w-x-e-d-c-b-p-u-g-s-t-z-n-h-O-G-L-S-eq-ne-ge-gt-le-lt-nt-ot-ef-a-oЍ؍k   ( 08@ HPX ` ||||hpx !,"#$|%x8&STRING2 cannot be emptynot a ttycannot get system nameunknownsnrvmpaA%7d f:s:cduEvery %ds:%-*s%s vforklwcL %7u %s totalUSER TTY IDLE FROM HOST%-10s %-8s 00:00m 00:%02dm %02d:%02dm %03ddays %02dyears %-8s %-12.12s %s %sVT_ACTIVATEVT_WAITACTIVE0: illegal VT numberVT_DISALLOCATE/dev/vc/0ioctl failed with %s, %s, %pbkeymapBad character size %dPIO_FONTX ioctl error (trying PIO_FONT)PIO_FONT ioctl errorError reading input fontFont too largeUnsupported psf file modeInput file: bad lengthPIO_UNIMAPCLRPIO_UNIMAPBad input file sizeThis is not a valid binary keymap.Error reading keymap flags/dev/vc/%dUnable to set new sessionc(K[?25hqdftu:a:umaskargUtuastat %s/proc/%d/exe/proc/%d/proc/%d/statopen pidfile %sopendir /procnothing in /proc - not mounted?K~S:S~KKSbqma:n:s:u:x:p:need at least one of -x, -p, -u, or -n-S needs -x or -a-m needs -pprocess in pidfile `%.200s'process(es) owned by `%s'internal error, please reportno %s found; none killed. warning: failed to kill %dstopped %s (pid).%s already running. %d unable to forkUnable to write pidfile '%s'unable to start %sbackgroundquietmake-pidfilestartasnamesignalexecpidfileKSbqma n(su0x8pPATH/bin/sbin/usr/bin/usr/sbin/usr/local/bin%s:%i: %sdiouxXeEfgGpopen%a %b %d %H:%M:%S %Z %YRSTARTRLENGTHWarning: unrecognized option '-W %s' ignored F:v:f:W:cmd. line()/>>>|++--++--$===+=-=*=/=%=^=+-**=**/%^*!=>=<=><!~~&&||?:in,|+-!]{}; ifdoforbreakcontinuedeleteprintprintfnextnextfilereturnexitwhileelseclosesystemfflushatan2cosexpintlograndsinsqrtsrandgensubgsubindexlengthmatchsplitsprintfsubsubstrsystimestrftimetolowertouppergetlinefuncfunctionBEGINENDCONVFMTOFMTFS*OFSORSRS*RTFILENAMESUBSEPARGINDARGCARGVERRNOFNRNRNF*IGNORECASE*ENVIRON$*%.6g%.6g /dev/stdin/dev/stdout/dev/stderrInvalid format specifier?Unexpected tokenUnexpected end of stringNot an arrayPossible syntax errorCall to undefined functionDivision by zeroToo few arguments for builtinInternal errorUnterminated {Empty filenameWrite failed. No previous regexp.Can't find label for jump to `%s'unterminated match expression; get_address: no address found in string missing commandbad option in substitution expressionaiconly a beginning address can be specified for edit commandsrwCommand only uses one address:btdDgGhHlnNpPqx={}Unsupported command %c--versionThis is not GNU sed version 4.0irne:f:Filename required for -iXXXXXXno temp filebad format in substitution expression"%s"%s line %d of %d --%d%%--These features are available: Pattern searches with / and ? Line marking with 'x Named buffers with "x Signal catching- ^C Job suspend and resume with ^Z Adapt to window re-sizesNo file [modified]%d%n[Hit return to continue](NULL)'%s' is not implementedNo current filenamecan't delete the charactercan't create room for new charactersNo filename givenTrying to insert a negative number (%d) of charactersTrying to insert file outside of memory"%s" %scould not open filecould not read file "%s"could not read all of file "%s"Put %d lines (%d chars) from [%c] Nothing in register %c()[]{}No previous regular expressionsearch hit BOTTOM, continuing at TOPsearch hit TOP, continuing at BOTTOMPattern not founddeleteNo write since last change (:edit! overrides)"%s" is not a regular file"%s" is not readable [New file]"%s"%s %dL, %dCNo address allowed on this commandfeatureslist $ nextNo write since last change (:%s! overrides)%d more file to editNo more files to edit"%s" %dL, %dCrewindNo write since last change (:rewind! overrides)wqyankYank %d lines (%d chars) into [%c]:s expression missing delimiters-- Insert ---- Replace --wW^0bBeEft$cdykjHL%+-{} ChangeDeleteYank%s %d lines (%d chars) using [%c]cdy><^%$0bBeEftH-k{L+j} (terminate)(bus error)(I tried to touch invalid memory)(alarm)-- caught signal %d %s--(window resize)(hangup)(interrupt)aAcCdDiIJoOpPrRsxX<>~hCROAOBOCODOHOF[A[B[C[D[H[F[1~[2~[4~[5~[6~OPOQOROS[15~[17~[18~[19~[20~[21~[23~[24~[11~[12~[13~[14~ (08@HPX`hpxȤФؤ $Id: vi.c,v 1.38 2004/08/19 19:15:06 andersen Exp $[%d;%dH-follow-print-name-type-perm-mtime-xdevcould not stat '.'could not stat '%s'-newerfile %s not foundoption `%s' requires an argumentinvalid argument `%s' to `%s'%s%c%i%cH-h:e*:f*:C-ABlnqvscFiHhe:f:LA:B:CEinvalid context length argument%s:%s: exited with status 255; aborting%s: stopped by signal %d%s: terminated by signal %d_+trn:s:e::can not fit single argument within argument list size limitargument line too longstack underflowstack overflow%s: syntax error.Error: base = %d is not supported. %x addsubmuldivexppowmodandnoteorxoro|Hj |X(Xu(0(x8@xHPhX` h <vp4afon:{%s}: %s: %7lo real %E user %u sys %T Command being timed: "%C" User time (seconds): %U System time (seconds): %S Percent of CPU this job got: %P Elapsed (wall clock) time (h:mm:ss or m:ss): %E Average shared text size (kbytes): %X Average unshared data size (kbytes): %D Average stack size (kbytes): %p Average total size (kbytes): %K Maximum resident set size (kbytes): %M Average resident set size (kbytes): %t Major (requiring I/O) page faults: %F Minor (reclaiming a frame) page faults: %R Voluntary context switches: %w Involuntary context switches: %c Swaps: %W File system inputs: %I File system outputs: %O Socket messages sent: %s Socket messages received: %r Signals delivered: %k Page size (bytes): %Z Exit status: %xreal %e user %U sys %Scannot forkcannot run %serror waiting for child processCommand stopped by signal %d Command terminated by signal %d Command exited with non-zero status %d write error%ldh %ldm %02lds%ldm %ld.%02lds%lu%%?%%%ld.%02ldcannot open module `%s'cannot mmap `%s'Module has wrong symbol versionInvalid parametersInvalid module formatUnknown symbol in modulecannot insert `%s': %s (%li).init%s multiply definedlocal symbol %s with index %ld exceeds local_symtab_size %lderror reading ELF headernot an ELF fileELF file not for this architectureELF file not a relocatable objectsection header size mismatch: %lu != %luerror reading ELF section headerserror reading ELF section dataRELA relocations not supported on this architecturecan't handle sections of type %ld.modinfosymbol size mismatch: %lu != %lurelocation entry size mismatch: %lu != %lulicenseGPLONLY_.kstrtab.kmodtab__this_module__ksymtabWarning: loading %s will taint the kernel: %s%s See %s for information about tainted modules http://www.tux.org/lkml/#export-taintedparm_invalid parameter %ssymbol for parameter %s not foundimproperly terminated string argument for %sparameter type 'c' for %s must be followed by the maximum sizestring too long for %s (max %ld)unknown parameter type '%c' for %stoo many values for %s (max %d)invalid argument syntax for %stoo few values for %s (min %d)cannot get realpath for %s.this???%s%s_O%s_M%0*lX_V%d%s%s_S%s_L%ldSections: Size %-*s Align Address%-15s %08lx %0*lx 2**%d Symbols:%0*lx %c %s fkqsvxmLo:%s.ko%s.o/lib/modules%s: no module by that name foundUsing %s Could not load the modulekernel_versionQM_MODULESquery_module: QM_INFO: %squery_module: QM_SYMBOLS: %skernel: QM_SYMBOLSUsing_VersionsNot configured to support old kernelsunresolved symbol %sno licensenon-GPL license - Unexpected return from obj_gpl_licenseforced load.got.pltcleanup_moduleA module named %s already existsCan't allocate kernel memory for module; needed %lu bytescreate_module: %sWarning: unhandled reloc %d Unhandled relocationDangerous relocationRelocation overflow%s of type %ld for %s%s of type %ldcorrupt module %s?init_module__ex_table.text.init.data.init__archdata__kallsymsinit_module: %sGPLGPL v2GPL and additional rightsDual BSD/GPLDual MPL/GPL.text.rodata.data.bss.sbssȷ/proc/sys/kernel/taintedHش (__insmod_Module Size Used by/proc/sys/kernel/tainted Tainted: %c%c%c Not tainted/proc/modulesmodule %s not found.-qexec of %s-t and -C not supportedacdklnqrst:vVC:/lib/modules//modules.dep/lib/modules/modules.dep/etc/modprobe.conf/etc/modules.conf/etc/conf.modulesaliasoffoptionsbelowcould not parse modules.dep failed to remove module %sNo module or pattern provided failed to load module %syou must be root to change the hostnamesethostnamedfisF:socketsocket6SIOGIFINDEXetherinvalid hw-addr %sSIOCGIFFLAGSSIOCSIFFLAGSmetricmtutxqueuelendstaddrnetmaskbroadcasthwpointopointdelarptrailerspromiscmulticastallmultidynamicupdownSIOCSIFMETRICSIOCSIFMTUSIOCSIFTXQLENSIOCSIFDSTADDRSIOCSIFNETMASKSIOCSIFBRDADDRSIOCSIFHWADDRSIOCSIFADDRSIOCDIFADDR8@HX`3hSxSCC  ȻػAA"C 0@P$ `p6`iface/sbin/start-stop-daemon --stop -x /usr/bin/wvdial -p /var/run/wvdial.%iface% -s 2/sbin/start-stop-daemon --start -x /usr/bin/wvdial -p /var/run/wvdial.%iface% -b -m -- [[ %provider% ]]poff [[%provider%]]pon [[%provider%]]bootpc [[--bootfile %bootfile%]] --dev %iface% [[--server %server%]] [[--hwaddr %hwaddr%]] --returniffail --serverbcast[[ route del default gw %gateway% %iface% ]]ifconfig %iface% downifconfig %iface% %address% netmask %netmask% [[broadcast %broadcast%]] [[pointopoint %pointopoint%]] [[media %media%]] [[mtu %mtu%]] [[hw %hwaddress%]] up[[ route add default gw %gateway% %iface% ]]ifconfig %iface% 127.0.0.1 downifconfig %iface% 127.0.0.1 upifconfig %iface% [[media %media%]] [[hw %hwaddress%]] [[mtu %mtu%]] upifconfig %iface% add %address%/%netmask%[[ route -A inet6 add ::/0 gw %gateway% ]]ifconfig %iface% del ::1ifconfig %iface% add ::1/sbin/udhcpckill -USR2 `cat /var/run/udhcpc.%iface%.pid 2>/dev/null` 2>/dev/nullkill -TERM `cat /var/run/udhcpc.%iface%.pid 2>/dev/null` 2>/dev/null/sbin/pumppump -i %iface% -k/sbin/dhclientkill -9 `cat /var/run/dhclient.%iface%.pid` 2>/dev/null/sbin/dhcpcddhcpcd -k %iface%udhcpc -b -p /var/run/udhcpc.%iface%.pid -i %iface% [[-H %hostname%]] [[-c %clientid%]]pump -i %iface% [[-h %hostname%]] [[-l %leasehours%]]dhclient -pf /var/run/dhclient.%iface%.pid %iface%dhcpcd [[-h %hostname%]] [[-i %vendor%]] [[-I %clientid%]] [[-l %leasetime%]] %iface% /etc/network/interfacesi:hvnamfmappingtoo few parameters for line "%s"too many parameters "%s"autointerface declared auto twice "%s"option with empty value "%s"pre-uppost-downduplicate option "%s"scriptduplicate script in mapping "%s"mapmisplaced option "%s"/var/run/ifstateinterface %s already configuredinterface %s not configuredRunning mapping script %s on %s Don't seem to have all the variables for %s/%s.Ignoring unknown interface %s%s=%sa+failed to truncate statefile %s: %sunknown address type "%s"unknown method "%s"duplicate interface "%s"IF_%s=%sIFACEADDRFAMMETHODMODE/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/binrun-parts /etc/network/if-%s.dinet6inetstaticloopbackwvdialpppbootpdhcpaddresslinktunneltunltcplp:i:e:reuseaddrbindlistenacceptconnectselectCONNECTINGCONNECTEDACC %-5s %-6ld %-11s %-10s %-13s %-6d - no support for `%s' on this system.laenrtuwxActive Internet connections (servers and established)(only servers)(w/o servers) Proto Recv-Q Send-Q Local Address Foreign Address State /proc/net/tcpAF INET (tcp)/proc/net/tcp6AF INET6 (tcp)/proc/net/udpAF INET (udp)/proc/net/udp6AF INET6 (udp)/proc/net/rawAF INET (raw)/proc/net/raw6AF INET6 (raw)Active UNIX domain sockets Proto RefCnt Flags Type State I-Node Path/proc/net/unixAF UNIXInode%p: %lX %lX %lX %X %X %d %swarning, got bogus unix line.unix??SEQPACKETUNKNOWNSTREAMDGRAMRAWRDMDISCONNECTINGFREELISTENING%d: %64[0-9A-Fa-f]:%X %64[0-9A-Fa-f]:%X %X %lX:%lX %X:%lX %lX %d %d %ld %512s %08X%08X%08X%08X%Xwarning, got bogus raw line.rawraw %6ld %6ld %-23s %-23s %-12s warning, got bogus udp line.ESTABLISHEDudpudp %6ld %6ld %-23s %-23s %-12s warning, got bogus tcp line.tcp %6ld %6ld %-23s %-23s %-12s SYN_SENTSYN_RECVFIN_WAIT1FIN_WAIT2TIME_WAITCLOSECLOSE_WAITLAST_ACKLISTENCLOSINGP0@P`p%d.%d.%d.%d%s %s Addresses: Address: *** Unknown hostServer:Name: sendtoping wrote %d chars; %d expected --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, %ld%% packet loss round-trip min/avg/max = %lu.%lu/%lu.%lu/%lu.%lu ms unknown address type; only AF_INET is currently supported.PING %s (%s): %d data bytes recvfrom%d bytes from %s: icmp_seq=%u ttl=%d time=%lu.%lu ms (DUP!)Address Mask Replyunknown ICMP typeEcho ReplyDestination UnreachableSource QuenchRedirect (change route)Echo RequestTime ExceededParameter ProblemTimestamp RequestTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestWarning: Got ICMP %d (%s)unknown address type; only AF_INET6 is currently supported.setsockopt(ICMP6_FILTER)%s: invalid interface name%d bytes from %s: icmp6_seq=%u ttl=%d time=%lu.%lu msMembership ReductionPacket too bigMembership QueryMembership Report/proc/net/routeMetric Ref Use MSS Window irttKernel IP routing table Destination Gateway Genmask Flags %s Iface %*[^ ] %63s%lx%lx%X%d%d%d%lx%d%d%d fscanf%-16s%-16s%-16s%-6s%5d %-5d %6d %s %-6d %-2d %7d %s -net-hostA:ne/proc/net/ipv6_routeKernel IPv6 routing table %-44s%-40sFlags Metric Ref Use Iface DestinationNext Hop%32s%x%*s%x%32s%x%x%x%x%s %s/%d%-43s %-39s %-5s %-6d %-2d %7d %-8s defaultresolving %sSIOC[ADD|DEL]RTgateway %s is a NETWORKlonetmask %.8x and host route conflictbogus netmask %snetmask and route address conflictadddeldelete GHRDMDAC metric netmaskgw gatewaymss windowirttdev device reject!mod"dyn #reinstate #net#host Entering character mode%s'^]'. Entering line mode%s'^C'. Console escape. Commands are: l go to line mode c go to character mode z suspend telnet e exit telnet continuing... USERal:Connection closed by foreign host. Escape character is gpl:r:local filetoo long remote-filenameoctetsendtimeoutlast timeoutserver says: %sUndefined errorFile not foundAccess violationDisk full or allocation errorIllegal TFTP operationUnknown transfer IDFile already existsNo such userhxmax ttl must be >1.port must be >0.nprobes must be >0.tos must be 0 to 255.wait must be >1 sec.dm:np:q:rs:t:w:vpacket size must be 0 <= s < %d.SO_SNDBUFIP_HDRINCLunknown host %straceroute to %s (%s) from %s, %d hops max, %d byte packets %2d traceroute: wrote %s %d chars, ret=%d %s (%s) %g ms ! !N !H !P !F !S *buffer overflowABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/http://httpftp://tfpnot an http or ftp url: %sbad header line: %sr+fdopen() %-20.20s %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5d %c%c - stalled - --:-- ETA%2d:%02d:%02d ETA%s%s fgets()*cqO::P:Y:extra_headers buffer too small(need %i)ftp_proxyhttp_proxyindex.htmlcannot specify continue (-c) without a filename (-O)fstat()Connecting to %s[%s]:%d too many redirectionsGET %stp://[%s]:%d/%s HTTP/1.1 GET %stp://%s:%d/%s HTTP/1.1 htGET /%s HTTP/1.1 Host: %s User-Agent: Wget Authorization: Basic %s Proxy-Authorization: Basic %s Range: bytes=%ld- Connection: close no response from serverserver returned error %d: %scontent-lengthcontent-length %s is garbagetransfer-encodingchunkedserver wants to do %s transfer encodinglocationanonymous:busybox@USER PASS ftp login: %sCDUPTYPE ISIZE /SIZE value is garbagePASVPASV: %sREST %ldRETR /RETR: %snetwork read errorftp error: %sQUITcontinuepassive-ftpoutput-documentheaderdirectory-prefixproxyPcq`pOPY KMGTP-familyinvalid protocol family-4-6-0-oneline\LOOPBACK%sBROADCAST%sPOINTOPOINT%sMULTICAST%sNOARP%sUP%s,M-DOWN> peeranycastinvalid scope value.localNot enough information: "dev" argument is required."dev" (%s) must match "label" (%s).Broadcast can be set only for IPv4 addressesCannot find device "%s"Failed to send flush request wrong nlmsg len %dDeleted %u: %s inet inet6 family %d peer %s/%d brd %s any %s scope %s secondary tentative deprecated dynamic flags %02x valid_lft forevervalid_lft %dsec preferred_lft forever preferred_lft %dsec %sFlush requires arguments. Cannot flush link addresses. allinvalid "scope" devCannot send dump requestDump terminatedDevice "%s" does not exist.Flush terminated nil ifname%d: %s@NONE: @%s: : mtu %u qdisc %s master %s SIOCGIFXQLENqlen %d link/%s peer brd Unknown command %sshowlstremotebrdscopetoh00Error: argument of "%s" must be "on" or "off"Wrong address (%s) length: expected %d bytesCannot create control socketSIOCSIFHWBROADCASTsetInvalid "mtu" value noarpNot enough of information: "dev" argument is required.SIOCSIFNAMECommand "%s" is unknown.Not a route: %08x %08x %08x %s/%u 0/%d default from %s/%u from %s from 0/%u via %s dev %s src %s metric %d %s cache expires %dsec error %d iif %s"ip route flush" requires arguments. protocolinvalid "protocol" oifiiffromexactcachemaininvalid "table"/proc/sys/net/ipv4/route/flushCannot open "%s" -1Cannot flush routing cache Nothing to flush. need at least destination addressAn error :-)Not a route?Wrong len %dFailed to connect the routesrcvia"mtu" value is invalid "protocol" value is invalid appendchangechggetprependreplacenotifyconnectedUx (ioctlipipip/ipYou managed to ask for more than one tunnel mode.gregre/ipsitipv6/ipCannot guess tunnel mode.keyinvalid value of "key"ikeyinvalid value of "ikey"okeyinvalid value of "okey"iseqoseqcsumicsumocsumnopmtudiscpmtudiscanyttlinheritinvalid TTL TTL must be <=255 tosdsfieldbad TOS valueKeys are not allowed with ipip and sit.Broadcast tunnel requires a source address.tunl0gre0sit0ttl != 0 and noptmudisc are incompatiblecannot determine tunnel mode (ipip, gre or sit)ipv6%s: %s/ip remote %s local %s dev %s ttl %d ttl inherit tos inherit%c%s nopmtudisc key %s ikey %s okey %s %s Drop packets out of sequence. %s Checksum in received packet is required.%s Sequence packets on output.%s Checksum output packets./proc/net/devfopenWrong format of /proc/net/dev. Sorry.%ld%ld%ld%ld%ld%ld%ld%*d%ld%ld%ld%ld%ld%ld%ldFailed to get type of [%s]!!!Deficit %d, rta_len=%drtnl_from_file: fread!!!malformed message: len=%d @%lurtnl-from_file: truncated messageOVERRUNEOF on netlinkSender address length == %dTruncated message!!!malformed message: len=%dMessage truncated!!!Remnant of size %dsender address length == %dERROR truncatedRTNETLINK answersCannot talk to rtnetlinkUnexpected reply!!!Cannot open netlink socketCannot bind netlink socketCannot getsocknameWrong address length %dWrong address family %d"%s" is invalid lladdr.:%02xDump terminated if%d[%d]genericeetherax25pronetchaosieee802arcnetatalkdlciatmmetricomieee1394slipcslipslip6cslip6rsrvdadaptrosex25hwx25hdlclapbddcmprawhdlctunnel6fradskipltalkfddibifip/ddppimreghippieconetirdafcppfcalfcplfcfb0fcfb1fcfb2fcfb3fcfb4fcfb5fcfb6fcfb7fcfb8fcfb9fcfb10fcfb11fcfb12ieee802.11voidHPX`hpx (08@H P  X ` 0Qhpx (U!0x%x %s 0x%x %s #%d %s %d %s #Database %s is corrupted at %s /etc/iproute2/rt_dsfield/etc/iproute2/rt_tables/etc/iproute2/rt_realmsnowherehostsite/etc/iproute2/rt_scopes/etc/iproute2/rt_protos0x%02xunspecglobalnoneredirectkernelgatedramrtzebrabirdnatprohibitunreachableblackholexresolveunicastthrow/proc/net/psched%*08x%*08x%08x%08xeither "%s" is duplicate, or "%s" is a garbage.duplicate "%s": "%s" is the second value.argument "%s" is wrong: %sCommand line is not complete. Try option "help"an IP address is expected rather than "%s""%s" may be inet address, but it is not allowed in this context.an inet address is expected rather than "%s".c:fbH:h:i:np:qr:s:t:vudhcpcd, version %s 0.9.9-predeconfigFATAL: couldn't listen on socket, %mleasefailNo lease, forking to background.No lease, failing.Lease lost, entering init stateNo lease time with ACK, using 1 hour leaseLease of %s obtained, lease time %ldrenewboundReceived DHCP NAKnakPerforming a DHCP renewUnicasting a release of %s to %sEntering released stateReceived SIGTERMeth0/usr/share/udhcpc/default.scriptclientidclientid-noneforegroundinterfacenowrequestretrytime8cHCXfbRHRhhixn8pȆqrstvreceived bogus message (bad magic) -- ignoringSending renew...Sending discover...Sending select for %s.../dev/urandomCould not load seed from /dev/urandom: %mSending release...<udhcp 0.9.9-prenomask=%dsiaddr=boot_file=%ssname=%sscript %s failed: %m%s%d.%d.%d.%dinterface=%s/bin:/usr/bin:/sbin:/usr/sbinHOMEip=%s=" /etc/udhcpd.confmax_leases value (%lu) not sane, setting to %lu insteadFATAL: couldn't create server socket, %mReceived a SIGUSR1Received a SIGTERMFound static lease: %x send OFFER failedunsupported DHCP message (%02x) -- ignoring =Failure parsing line %d of %sUnable to open %s for readingToo many leases while loading %s Unable to open %s for writing%s %sunable to open config file: %s , , /-192.168.0.20end192.168.0.254optionoptmax_leases254remainingauto_time7200decline_time3600conflict_timeoffer_time60min_leaselease_file/var/lib/misc/udhcpd.leases/var/run/udhcpd.pidnotify_filesiaddr0.0.0.0snameboot_filestatic_leaseP (8P @h P  PX  P` pxH U      8 8 PHP PX P` Pp PPP%s belongs to someone, reserving it for %ld secondssending ACK to %sno IP addresses to give -- OFFER abandonedlease pool is full -- OFFER abandonedsending OFFER of %s%s (v%s) startedforkOption 0x%02x did not fit into the packet!bogus packet, option fields too long.received bogus message, ignoringMSFT 98pidfile_open: open %s failed: %m pidfile_open: lock %s failed: %m pidfile_store: lseek %s failed: %m pidfile_store: write %s failed: %m pidfile_store: ftruncate %d failed (%s): %m pidfile_reassign: filename is NULL pidfile_acquire: filename is NULL pidfile_check: lseek %s failed: %m pidfile_check: read %s failed: %m pidfile_check: ignoring bogus pid (%s) in %s pidfile_check: process %d exists (%s) pidfile_check: kill %d failed (%s): %m SIOCGIFADDR failed, is the interface up and configured?: %mSIOCGIFINDEX failed!: %mSIOCGIFHWADDR failed!: %msocket failed!: %mCould not setsocketopt on raw socketusedsharedbuffers%6s%13ld%13ld%13ld%13ld%13ld Mem:%6s%13ld%13ld%13ld Swap:Total:%6s%13s%13s%13s%13s%13s %2d) %-16sbad signal name '%s'Bad PID '%s'Could not kill pid '%d'%s: no process killedCould not kill pid '%ld' PID Uid VmSize Stat Command%5d %-8s %s %5d %-8s %6ld %s [%s] %d: old priority %d, new priority %d %d: setpriorityd:chdir('/proc')scandir('/proc')/proc not be mounted?statcpu %lu %lu %lu %lumeminfoMemTotal: %lu %s Mem: %lu %lu %lu %lu %lu %luMemFree: %lu %s MemShared: %lu %s Buffers: %lu %s Cached: %lu %s loadavg%f %f %ffailed to read '%s'Mem: %ldK used, %ldK free, %ldK shrd, %ldK buff, %ldK cached Load average: %.2f, %.2f, %.2f (State: S=sleeping R=running, W=waiting)  PID USER STATUS RSS PPID %%CPU %%MEM COMMAND %6ldM%7ld%5d %-8s %s %s %5d %2d.%d %2u.%u %d day%s, %2d:%02d, %d min, load average: %ld.%02ld, %ld.%02ld, %ld.%02ld %02d:%02d:%02d up builtin | %s%s: %d: %d: %mSyntax error: %sIllegal option -%cNo arg for -%c optionLP%s: %s not found unaliasparameter not set or null%.*s: %s%scan't shift that manyNo previous jobNo current jobNo such job: %s%s: ambiguousjob %s not created under job controlBad fd numberYou have stopped jobs. unlimited %lld Current option settings %-16s%s Illegal option -o %sloginCan't open %sOut of file descriptorsCannot set tty process group (%m)/dev/ttycan't access tty; job control turned offsh: turning off NDELAY mode $(())${#${"}$(...)"$(...)"<&<<... && <>until || | ; if ; then ; fi; else while ; do ; donefor in () { ... }esaccase ) ;; >|>>>&%s unexpected (expecting %s) (core dumped)Done(%d)Done[%d] %.4o Illegal mode: %sHSatfdscmlpnvwtoo many argumentsbad number%-20s error setting limit (%m)trap -- %s %s %s: bad trap%s=%s %ldm%ld.%.3lds%c%s%s%.*s%s Usage: kill [-s sigspec | -signum | -sigspec] [pid | job]... or kill -l [exitstatus]invalid signal number or name: %sls:invalid signal number or exit status: %skill %d: %s[%d] Running | %*c%d %s%*c%slpCannot fork%.*s: is read only%.*s: bad variable name%lldexponent less than 0divide by zeroexpression recursion loop detectedexpression expectedvfUsage: getopts optstring var [arg]OPTARGIllegal option -%c No arg for -%c option OPTINDOLDPWDPWDCDPATHcan't cd to %sp:rarg countIFSPipe call failedDirectory nonexistentcannot create %s: %sNo such filecannot open %s: %sMissing '))'Unterminated quoted stringMissing '}'Bad substitutionEOF in backquote substitutionIllegal eof marker for << redirectionBad for loop variableBad function name Use "exit" to leave shell. %builtinfunc%s not defined in %s is a shell keyword is an alias for %s a tracked alias for is%s %s is a shell functionspecial is a %sshell builtin: not found %s%s PS1=\w \$ PPID-c requires an argument/etc/profile.profileENVPS1=$ PS2=> PS4=+ OPTIND=1eerrexitfnoglobIignoreeofiinteractivemmonitornnoexecsstdinxxtracevverboseCnoclobberaallexportbnotifyunounsetqquietprofileend of file);;`dodoneelifelseesacfithen}3.3:6alias2bg3break2cd0chdir3continue3eval3exec3exit7export2false2fg2getopts0hash2jobs2kill0let4local0pwd2read7readonly3return3set3shift3times3trap2true0type0ulimit2umask2unalias3unset2waittime(seconds)file(blocks)data(kbytes)stack(kbytes)coredump(blocks)memory(kbytes)locked memory(kbytes)nofilesvmemory(kbytes)locks}%%##IFS= Illegal number: %s 08HXhpxnewlineredirectionword;&&&|||(!caseforifinuntilwhile{ (08}-+?=         !"$&'()*-/:;<=>?[\]`|}~ ()&|;  @=@̇HPXl`Lh@Ap@AxL:l\<x79@4E:( (0\8@H P Xh8p@ rwxugoxtfdscmlpn v w%s: not found   %s <<=>>=<< >>,||&&!=*<=k>=K== |=B&="*=/=#%=C+=-=--3^=b++**/!0< >+=|& */.%N+ --^~,?:$)4(HOME=:\W Hj||x (\W *?[XpPATH=/usr/local/bin:/usr/bin:/sbin:/bin./../%*s[%dD[%dA[%dC `"#$%^&*()=+{}[]:;'|\<>c:ndaemonklogd started: BusyBox v1.01 (2008.03.05-18:48+0000)klogd: Error return from sys_sycall: %d - %m. Kernel log daemon exiting.unknown facility name: %sunknown priority name: %sp:st:Can't find circular bufferCan't get access to circular buffer from syslogdCan't get access to semaphone(s) for circular buffer from syslogdsemop[SMrdn]semop[SMrup]cannot create socketsemop[SMwdn]Weird! Can't find the terminator token??? Weird! Can't find the terminator token from the beginning??? semop[SMwup]/dev/consoleBummer, can't print: <%d>%s.%s<%d>%s%s %s %s %s -- MARK --shmgetshmatsemgetBuffer already allocated just grab the semaphore?m:nO:s:Sb:R:LC::Couldn't get file descriptor for socket /dev/logCould not connect to socket /dev/logCould not set permission on /dev/logsyslogd started: BusyBox v1.01 (2008.03.05-18:48+0000)select errorUNIX socket errorExiting Syslogd!System log daemon exiting.alertcritdebugemergerrinfonoticepanicwarnwarningauthauthprivcronkernlprmailmarknewssecuritysysloguucplocal0local1local2local3local4local5local6local7/var/log/messagescn:s:/dev/fb/0/dev/fb0fbset(open)fbset(ioctl)mode reading not compiled inUnknown video mode `%s' mode "%ux%u-%u" # D: %.3f MHz, H: %.3f kHz, V: %.3f Hz geometry %u %u %u %u %u timings %u %u %u %u %u %u %u accel %s rgba %u/%u,%u/%u,%u/%u,%u/%u endmode -fb-db-accel-hsync-vsync-laced-double-all-xres-yres-vxres-vyres-depth-match-geometry-pixclock-left-right-upper-lower-hslen-vslen-timings-csync-gsync-extsync-bcast-rgba-step-moveh!p! u (x!!!!! 8 ! !d!e!f!g!h!i!!j!k"l"m"n"o "p("8"q@"rH"sX"t`"uh"vp"wdiscpart%*.*s%s%-2u%s %c %11llu %11llu %11llu%c %2x %s Partition table entries are not in disk ordercylindersectorcylinderssectorsUnknown%c: unknown command Disk %s: %ld MB, %lld bytes Disk %s: %ld.%ld GB, %lld bytes %d heads, %d sectors/track, %d cylinders, total %llu sectors Units = %s of %d * %d = %d bytes Partition %d has different physical/logical beginnings (non-Linux?): phys=(%d, %d, %d) logical=(%d, %d, %d) Partition %d has different physical/logical endings: Partition %i does not end on cylinder boundary. %c%2x %-15.15sYou must setheads and %s%s. You can do this from the extra functions menu. BLKGETSIZE ioctl failed on %s Fatal error Unable to open %s Unable to read %s Unable to seek on %s Unable to write %s You will not be able to write the partition table.Note: sector size is %d (not %d) Device contains neither a valid DOS partition table, nor Sun, SGI or OSF disklabel Internal error The number of cylinders for this disk is set to %d. There is nothing wrong with that, but this is larger than 1024, and could in certain setups cause problems with: 1) software that runs at boot time (e.g., old versions of LILO) 2) booting and partitioning software from other OSs (e.g., DOS FDISK, OS/2 FDISK) Ignoring extra extended partition %d Bad offset in primary extended partition Warning: deleting partitions after %d Warning: extra link pointer in partition table %d Warning: ignoring extra data in partition table %d omitting empty partition (%d) Warning: invalid flag 0x%04x of partition table %d will be corrected by w(rite) Building a new DOS disklabel. Changes will remain in memory only, until you decide to write them. After that, of course, the previous content won't be recoverable. got EOF thrice - exiting.. %s (%u-%u, default %u): Using default value %u Value out of range.%s (%u-%u): Partition numberWarning: partition %d has empty type Selected partition %d All primary partitions have been defined already!No partition is defined yet!Partition %d is already defined. Delete it before re-adding it. First %sSector %llu is already allocated No free sectors availableLast %s or +size or +sizeM or +sizeKWarning: bad start-of-data in partition %d Warning: partition %d contains sector 0 Partition %d: head %d greater than maximum %d Partition %d: sector %d greater than maximum %d Partitions %d: cylinder %llu greater than maximum %d Partition %d: previous sectors %llu disagrees with total %llu Warning: partition %d overlaps partition %d. Warning: partition %d is empty Logical partition %d not entirely in partition %d Total allocated sectors %d greater than the maximum %d %d unallocated sectors %*s Boot Start End Blocks Id System Device/dev/hd/proc/ide/%s/mediacdromtapeDisk %s doesn't contain a valid partition table Cannot open %s Command action a toggle a bootable flag b edit bsd disklabel c toggle the dos compatibility flag d delete a partition l list known partition types m print this menu n add a new partition o create a new empty DOS partition table p print the partition table q quit without saving changes s create a new empty Sun disklabel t change a partition's system id u change display/entry units v verify the partition table w write table to disk and exitfdisk v2.12b:C:H:lS:uvVWarning: the -b (set sector size) option should be used with one specified device/proc/partitions %d %d %d %[^ ]/dev/%sCommand (m for help): WARNING: Partition %d is an extended partition DOS Compatibility flag is setDOS Compatibility flag is not setThe maximum number of partitions has been createdYou must delete some partition and add an extended partition firstl logical (5 or over)e extended%s %s p primary partition (1-4) Invalid partition number for type `%c' Partition %d does not exist yet! Hex code (type L to list codes): Type 0 means free space to many systems (but not to Linux). Having partitions of type 0 is probably unwise. You can delete a partition using the `d' command.You cannot change a partition into an extended one or vice versa Delete it first.Changed system type of partition %d to %x (%s) Changing display/entry units to %s The partition table has been altered! Calling ioctl() to re-read partition table. WARNING: Re-reading the partition table failed with error %d: %s. The kernel still uses the old table. The new table will be used at the next reboot. WARNING: If you have created or modified any DOS 6.x partitions, please see the fdisk manual page for additional information.Syncing disks.FAT12FAT16 <32MExtendedFAT16HPFS/NTFS OS/2 Boot Manager Win95 FAT32 Win95 FAT32 (LBA)Win95 FAT16 (LBA)Win95 Ext'd (LBA)Hidden FAT12Compaq diagnosticsHidden FAT16 <32MHidden FAT16Hidden HPFS/NTFSHidden Win95 FAT32Hidden Win95 FAT32 (LBA)Hidden Win95 FAT16 (LBA)[`5S  ('(08̔TSؔL>4C O8XX d 0m,0Xwu80|DPPF \0hLt0T 00ȕ0ԕL 704< Xwd(0 4@`L8XX#dP)p0|05=0DPL0!R0ZĖ4_Ж0gܖ0m@E xHLP ~H 0;0 $04<H0)T `l<x,D00(̗Xؗ'0+/6<><d F ,<M88RD Q ZPa\Hjh4rytT$ $H Ș,Ԙ`048G(04,@ memcpyabortlibc.so.0putcharstrcpyunsetenvwaitpidioctlrecvsigemptysetstrerrorgetopt_longsnprintfsyscallmunmapmknod__ctype_bgetenvsetpriorityusleepgetpidfgetsfcntl64readlinkdup2getuidmallocstrtoulrmdirsocketselectputenvclearenvchownstrncasecmpchmodfstat64alarmstrtolpipestrnlenrenamestrrchrwritefprintfbindvprintfchdirsetsockoptumaskstrstrreadopenlogstrlcpycloselogstrncmpstrncpyunlinkstrcasecmpsendtoreallocreaddir64memcmpfdopenforksscanfexecvlstat64sigaction__uClibc_mainstrtoullsymlinkmemsetfnmatchstrlcatfclosetimeopendirstrcmpgetpwnamsprintfstderrmmap64strsep__errno_locationgetgrnamatoivsyslog_exitstrlenstrchrfputs__data_startsetsidclosedirrecvmsgmkdirfreefopen64__environ__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__'`DHLPTX\`d h l p t x| !"#%&()*+,-./012356789 ;=>?A B$C(D,E0F4G8H<I@JDKHLLMPNTOXP\Q`RdShUlVpXtYxZ|[]^_abefghijklmopqrstu -L-cƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ  --- 00<xGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/-(M0 S R/Ѝ/d RQ//Q/ /R 0S/ 0S Q/P P P P 00 (0 00 @<DH? 0 =A-Mlp,&(,.(,*(,@%(d&X, (L, (D, (@, (d&X P X< ''i/P/>- '0@0S P @0T0@0S P @\0TX\ '  @o X'ۍj<<A 0@-@ SH0 0<0<0 P p@ <-PMЍ_-t00@-0MPP@X0 0S <@3 @Ѝ0@ Ѝ/$<E-MYpn Pw222PR@ `h  OD20 㠀: 5 1 - )@`PPPG a,'Z>@P>P=SFh10SB y@c@@!@mkT #9 0!^ 60C`p0 0c0 `p0K 0C00gcpp @86\C0<< 00,*Ѝ<(<H<=#O-0EM$MS PP P*\qW @@D E-P@ 03p3P30W^ 0030 0PpP [pA7 <Oup` * %@E- T0 )PCE-E=P 0 E͍E͍5P *P1 S,\0RS0pWS L@\0!@ k10W]1t1@4 40S0 00SP48`V 0LS PP%@0T1@Z X{P8`V 0S PlP@0T PT0UOp0 P0PYp8YߍڍP=`=h=T8===P<O-MPP>. P PUm:p`n 0vO@̍8uqzP Op^x0-2 P Pj0-n00 <00 4ʍ 06  j:* $v >p "0bS 3,]j +,UP &0,KN<! 00PP PT0`,30090SX}  h: 0@PE_0) _QM @ 9Q L4E2ʍ4    O?\ZP8@@D$/D*#*#/&Ph(?0P(8!P  @8)`P P  4V?U0PEET 8@@D  ,P,4  (E6007, 70d'@P  7'`PP OP'0 00P8@@D Pp uU D'Ņ10007 $70&0P6 q 060S 777Q 70R Q$7S``0St7̍8 T2 `12 `18 `!$7 `! ,28 `!6!`!\2 ̍8!`11`1$ 0 `P &P >0$c ̍82 1`132 |(pIO W](P: ,F(v<ʍ(05<050 5PP 0 5 S%R 0S 0S $z yP0H20CSg <`̲I] P=P(0 0@00`S#0K#0@ M@#H4 3#,4 0*L2xT#:L“\2$ s#L24ʍL"2"L2ʍL"2"\3 "h382 1`132 Ds ,0_@P FP ^x0"d2T@!G`f@PPr 0 0 hppp @,@@` P00  P00  P 00  P0 0 h Pz ==@G $=>>0>x>P>h>8G>>G>>?(?P?Gx????@ 8@P@p@j8@@@@@0APAPhA`=xAAATP=AABXBB0B`BBGBBC CPCCCC(DpDDDE PEXEhExEEEEEEEEEGF FGPFF TF8GD< HFHL@( X@A P 080&  P  P 8 P -  P "<0pW Y`` h!0 6":0. @ &1 Č T!@0 800s03[0S !0@0 0@!S@@ 0S$$"O0,"1I+D@PXX"2 PpWM@# p 20S 2 0PP @ <0S 2 0PP .(#3 PP 382 1`132 M ,LPSP'281`1 32 ,0 Pʍ0P3 @P#00:0&"($0S 00(VP$0S009 0 wP206 <C406 CH0p 0$0c0 p4 0<<S0ʍ006065*0`pW `45V@%0S 00T50SSd50S PdEx- PDP@5P;5P65P"1 P,$@PJ(@,,$i/`P&,ߍۍ $,*"*/:D #: 0@-Č0 @P 0 6":&0M0@-M@LPPD ~ @P4 0<Ѝ0@Ѝ/0H@HHH- M@ 3 P 0, fP  ЍxHH@-@^[- X@@-@PP @.V0.-  0><H 8D ()(;)kgHG->M0MP`qP; aN@D?P 4:P/ePmV-GT8 @P \?\? P0$ 0q@EP-T ppPa@@P)P=S 0 $GGT 0q~pOP 0#p1\OTj ?P 0# j`  @  L P: 0;P    P "0@ s obJ@ P`Fx 0S{v : 0 00! %0` `F *D/PW @@*E0 t     0 0X2 a9P, *@PT=SDK Hq>0 {2@-=0Tq,PmV +P=S dX U 'P 0I (0Ѝڍ<HHHJIH I@IJxI#IIWPJ(J8J@JPJpJxJIE-M"B0000P PP ,/x/P q hd"<2l   Pp 825P105:("1tPEUP 00 `#RI @ !> 1bB@000 P R0N 0 =R0000 `"Q@@P; `HP,: P,//(P00X: QrP ,\T/ gP H0pL (0nߍJJJJK KKHKKKKKKK $,*"*/  /@-GMMOph,\,q, PD>0 (4S,4S 0 !4O0 \?SP( {L]U0 PU` `\?`S02@@D VD ?tЍۍjL(aPLpLxLLE-46kM4M(6k0kM(@:p[0JJ`P%!@a,V,^,Z@%0`Tʍ芜W0|%\OTQ PTH%0`0 @?PXϗ0 %4k00S X? S*0q*"@X "@P P0Xϔ 0$h`4k00S X? S0q"@*X~k=(0X3k-0 0S0#DL @@D,0P"PE,,0# +\OT }P3 ˍ0 @h#0`/S`< 00C R;0@;00S /S0 S@,@L @@Dk`PjxPS:: S Spp*"0ePK*(:*:R*8:R *<:R0 "@5< " 0ˍ0CP S)L @!0@D,Pk-0 0xCM@P0p!PE\!0dP%P9 kJ`@0@D,![! P!PE pP *D 0@gP 4l 0`Wߍۍ(QjLpaLLM@MhMMMMaNHNNNNO 0O@O`OA-1M`0 @|!0y "?P,,@,$,pΆ@ W0!P 0S  fXY (IP @TP>0UqN@qP  @@ 0<ߍ(QjOPaOOOO-PM@`paP宏  [P 3PP82*:SH2SL2S !0A 0xP: P0PExp!l!d\! 0`P /I0@0  0 @3P 3 0@V"zP !0h D[Y   ]P D$ 0 0 ߍOOaO 0O0P`OXPxPO-BM MOp,,q,Nf`P B $40S dN@P B $40S +n@(˗O0! \?S (˗ PNT /L=SF 8 P |P0@L=L͗?  \?S' 0>@#J`N: #:(˗ 0P 0 6@":& 0 L͗(J XD ? ,ЍۍjHP@apLPPLp@-MM@*`*PP -0 QJ0P@, 0S .S | ߍڍpaacA-MM`P***@dypP 0 P0 PzJ0P@, 0S .S 1 Pߍڍaacb@-@PMp<l ,t` ofЍ@,(bA-M@`p+ S+ [P+ VKe,B + G+ CW 0pp   Xi/9P u@4 0 ܍aj8bcAXbp@-\oMPV , q  I @>0T ܍pA- M0@_p',n`P 0 5: S K#@9,50P -0q,xaC\0H# WW.P 0 tt%`0A0CS񟗥P,,,,,,,,,,,, P@1L#@Dq @07 P@1L#P@DPE =W.@W> 0xELR|"xŝ 0 .6": &Č 0  Z P@1L#P@DPE -0 F P@1L#P@DPE = 0x5BYX6 P@1L#P@DPE = 0x5BGL $ P@1L#P@DPE u= 0x5B5T  P@1L#P@DPE c-0-  x5L30pXI:t7SݍxbbcbbHE-\?MS@, Z9^PSD+-=0RL=ST=S qP[ |0 @dP L0@! Hq. ,KIH 3@`T >`&DL&J. $J ` 0 +X/'TR $L-R T-R tDK@-=0T Lf ߍc@H0ccXc`chcxccccA-VMMLP`,<p,C,?,;1@DP4 @l1TPPM /",0l0PP@P:%: S ,r@P@D.V. 0/hC PO"! S   `P{,@1T T V. 0 hCO,BZߍۍ jA-MLP,, ,'P `#; 04B`| }P l 0f@QP 00T/@4  ۍ MUUUUjO-Mp, `P PLi t { P  f n XuP LiH U ] pdP-,D:~0Pq Li `8 @ < 7 oPK t " *d5Li@  8   MP)      8P      #P 3: Si  ߍ d d0d8d@dPdXdhdxdj@- p@MP,`T ,V  ,/SP O, !S00 0SH0`@0Q00 ,Ѝ@ЍA-PPMM"  JP  DP t >P ` 8P L 2P 8 ,PK@@D,R/K0S3PaP P3k``FU L,8,@)P8: S]P=P PH3UA 4`P  # O0@DAJ P,, ,  ,gPHچ>0 0h8B /9h pP O,/PpS U$ P K  pP,,, ,)P5چ. 0hxC /_P()oP L sPd $ kP/B0  `P /70P,O@D,},, ,Pچ>0 0/h8B P  ,`D0P ``0PhЍۍhd d@d0dxdd  dOdXdPd8ddd@-PM`U: p, 7 /P @/ P- P  P /0P P 6P /P P , D,  =P @ Pߍddd0@-PMP @TЍ0-\M?P,L @/00,(0( 0 0 Ѝd d0@-@  0 0x00@X0 \T0@  40 0,00@0 \  $,*"*/  /O-M MN`,̍̍̍̍ PL@$ 0Q'S0<,0 R 0 Sx. 0Q @>0!0< @0,,&X 60SP50S P `z%0_ /kP N@@D,% ,- @ppF P OPe PaL@P<Sy<SsL#=0$b Pc < P\ 5 A 0t$SSxx 0E @0P($9Pʐ<Sڜ P P 0NPP0S^ڮ2. 0 00̝\ڬ2. 0  00\  0PP0S PKڠ210 S2B An``F#@@Pʘ T@Lo 0"e. 0XXC P U*  xH" 0A>00C< <S0S 8" 0$bP P7ڠ210 S2. A^PPE!@Pʐ t0T< Hb0d!>0 08B\ <S0S X! 0s8'P^Dʐ<SA PD P@X 0 0Q ̝  LĠ 0d G<S D 0>@q@O ЍۍOOfmfgx>g8gXgxgggg(>gh(hPhp@-P M BR`c?, @| P00 @P T0S0S܍pO-M  h   P* 0P 1||!|1QPEUM 00 p#RF @ !> 1`rB`000 =PPpp- @p'Q"QPxPp rP00PG@P 0| 0h P 0`-  ,  00Y:ߍHKm8JhhE-AM[P`",  ]5@P P pp /-0P p  ]P V  0S  0 AߍO-bMM  ^$S0PS $S v00` NPQ p@THH&$00 0<%S;PQ %Q AN@, +005 0000 a PVʠ%0  t 0S 0S%000XD%P0SDpPp0P0{S`}@P$`00`PA,M0G S  $<Pd|4  >  QQ>"N@D|>"N@D~ 1 X=S V- a  PP&ڄ30S  0  000 PU"N@D,60+S  PP"AV"A @@Da>,0P Q |PPP 0P qPP@ kPPk@Pu "@,"@,12P!04BPb>@  4R00 "N@D P0!B<@PF PPB Pq |6LkV~@0P 0-M @!1 Km͠``-    V P  0T  R k0S 00ɷA  3TߍۍHnh0nohhho i(iPi`ii iO-a>MM08  pWP*0 ? OP"0 ? GP0  0 ?P0 < 0 6P q>0 R/.PX10CSI %P @Έ T0\ V/`@00CS P < 0 P @0c/PV`1Sb 1^, ,N:,0P , , *0S" d, :,  ^, D ,4 ,< ,8 `N^mP hP)0J u`V0Bf0)w(PM0  0CSE 0co₮@: ,0P :Q P P   @ P (00S 00  00A*P @ (0Q 00  d> P P(0[0660?h PZ6?p PR6< 0x PPC F0  0CS: 0co@ BP <P0  @ { P <'00S 00  00A:P0@ &0Q 00  >P P0[ Pp 1S3 1Nc,@ ,c^@ <@P XM1SR % x1SS  P0%, 1S8 >0B/]PP01Sw 1Nc, ,$1S Pʍ  ;_PZ: c@QS*  P 0$B?* H:  8S3@P/ e`P+ P@DK = 0PP  0 P-   |@-=0⮍T,  @+T 1SP)0S$ 0@ , >-͈S M d0  P@ 80" P0ncχZ,(y0  Sr" 0"c@` ^O:,09P *0S N,7 ,? ,; :,6 8SN," , ) ,% ,!  N,^ ,0`!0PqU`P \?S  P70l [+0@ O (0[0 ?0 901S0TH P-qЍڍiii8JiiiH?d jddm edem Ne(eeeeeePi`iefnf0fkHf@HupfffPefO-8*MM hP SpPF @^Pn {` <! a>` @@044!@P@\ @1 .d0L 0PS T0#03:   "0  N@@D,2 ,U  0P 2 00 0>0X ߍۍiij0o@-MPp@PJ H1SP1St1S`1Sh1SP1 0? X0P=*@kV(1S 0CS H,1c 1202(1S 1@1S D1cnЍ(jmPjG-M`D DPP Z H10CSP1 0?$0P=0T=|1S X?PH$qW @8P 4SL},;Sp1S t1S0,;p1(; :S`1S S0 :dNc?,b ,$;Sh1S S0$;lN@c?,M ,p9SaP!0BS]R09P10CS ".T1@c,- ,Px1SS P0"2p p000  K@0@T4"s D02@ 000  2pX0S !0W (H10CS!L1qN@c,,x1SS t9P0T8!40L? !@-@KT(1S S0@;(10CS ,1c 12021@1S D1c DZ qN@xH 0,L;S - 0L;ߍ(jnhjOjj`ijjjPjj00/P 0cπP*0 1 00//|0@-@S 00@-`Mp(U*0@PP0\\@@  \ U0 yЍpuhvu0@-MP@  00 0(00H@\ Ѝ0 E-P M` pP PU@R@P0P r 00 020P@@0P ЍvA-@`pPP @TXP PPU@P ,0P@@0G-MP`P 0 'a@P 0S #S.Spp X. P P < 0   rߍvxv8v@-M @00S X P DP 0P @P Ѝ@vHvPvA-p_@`PP00=S  D0 0800b@PT  0 S/0S/0S/0S/0S/0S/@-@PM P J0 SER0@S?444444 0  0 0 0 0 0S"?0#\R R0R0R0r00SR >06 S udev: renamed network interface %s to %s dev%u:%urootchange%s: device event will be ignored%s: device node creation supressed%s: device '%s' already in database, cleanupnet%s: device renaming supressed%s: changing net interface name from '%s' to '%s'%s: error opening socket: %s%s: error changing netif name %s to %s: %s_rename%s: error changing net interface name %s to %s: %s%s: renamed netif to '%s'INTERFACE_OLDDEVPATHINTERFACE%s: changed devpath to '%s'remove%s: ignore_remove for '%s'udev_device_eventrename_netif/dev/etc/udev/udev.conf/etc/udev/rules.dUDEV_RUNUDEV_CONFIG_FILE%s: can't open '%s' as config file: %s%s: line too long, conf line skipped %s, line %dudev_rootudev_rulesudev_logUDEV_ROOTUDEV_LOG%s: error parsing %s, line %d:%dparse_config_file%s: device node '%s' points to a different device, skip removal%s: removing device node '%s'DEVNAME%s: removing all_partitions '%s[1-%i]'%s%d%s: found %i devices with name '%s'%s: no reference left, remove '%s'%s: found '%s' for '%s'%s: compare (our own) priority of '%s' %i >= %i%s: compare priority of '%s' %i > %i%s: missing target for '%s'%s: '%s' with target '%s' has the highest priority %i, create it../%s: found existing node instead of symlink '%s'%s: replace device node '%s' with symlink to our node '%s'%s: device node '%s' already exists, link '%s' will not overwrite it%s: found existing symlink '%s'%s: preserve already existing symlink '%s' to '%s'%s: creating symlink '%s' to '%s'%s: atomically replace '%s'.udev-tmp%s: symlink(%s, %s) failed: %s%s: rename(%s, %s) failed: %s%s: update symlink '%s' of '%s' DEVLINKS%s: update old symlink '%s' no longer belonging to '%s'block%s: preserve file '%s', because it has correct dev_t%s: mknod(%s, %#o, %u, %u) failed: %s%s: chmod(%s, %#o) failed: %s%s: chown(%s, %u, %u) failed: %s%s: creating device node '%s', major=%d, minor=%d, mode=%#o, uid=%d, gid=%drange%s: creating device partition nodes '%s[1-%i]'udev_node_removeudev_node_addudev_node_update_symlinksupdate_linknode_symlinkudev_node_mknod/.udev/db%s: no udev_db available '%s': %s/.udev/names/%s: no index directory '%s': %s%s: found index directory '%s'/.udev/db/%s: creating index: '%s'%s: removing index: '%s'%s: no db file to read %s: %s%s: found a symlink as db file%s: error reading db link %s: %s%s: error reading db file %s: %s%s: unable to create db link '%s': %s%s: unable to create db file '%s': %sN:%s S:%s M:%u:%u L:%u A:%u R:%u E:%s udev_db_get_all_entriesname_indexudev_db_get_deviceudev_db_add_deviceudev_db_get_devices_by_namesubsystem/subsystem//bus/module/module/drivers/drivers//devices//class//block//subsystem/bus/driver/class/block/deviceSYSFS_PATH/sysENV%s: '%s' %sexists%s: '%s' has mode=%#o and %s %#omatches%s: file '%s' appeared after %i loops%s: device disappeared while waiting for '%s'%s: wait for '%s' for %i mseconds%s: waiting for '%s' failedATTRKERNELSSUBSYSTEMSDRIVERSATTRSRESULT%s: can't open '%s': %s%s: unset ENV '%s'%s: set ENV '%s'%s: writing '%s' to sysfs file '%s'%s: error writing ATTR{%s}: %s%s: error opening ATTR{%s} for writing: %sdoes not existdoes not match%s: '%s'%s: pipe failed: %s/lib/udev/%s: open /dev/null failed: %s%s: program '%s' not found%s: exec of program '%s' failed%s: fork of '%s' failed: %s%s: stdin read failed: %s%s: ressize %ld too short%s: '%s' (stdout) '%s'%s: stderr read failed: %s%s: '%s' (stderr) '%s'%s: '%s' returned with status %i%s: '%s' abnormal exit%s: updating devpath from '%s' to '%s'%s: unknown format variable '%s'%s: format parsing error '%s'%s: unknown format char '%c'%s: missing closing brace for format%d%s: missing file parameter for attr#+-.:=@_/ $%?,%s: %i character(s) replaced%s/.tmp-%u-%u%s: unknown substitution type=%iACTIONKERNELSUBSYSTEMDRIVERNAMESYMLINKsocket:%s@%s%s: passed %zi bytes to socket '%s', %s: rule applied, '%s' is ignored%s: reset run list%s: link_priority=%i%s: reset symlink list#+-.:=@_/ %s: add symlink '%s'#+-.:=@_/%s: rule applied, '%s' becomes '%s'%s: no node name set, will use kernel name '%s'devpathnumberkerneliddrivermajorminorresultattrsysfsparenttempnodesysenvudev_rules_get_runmatch_rulewait_for_sysfsrun_programimport_keys_into_envimport_file_into_envudev_rules_get_nameudev_rules_apply_format(kp0kn8kk@kbHkdPkMXkm`kchks pks xkP kN Hr kS kEget_format_lenget_format_attributepass_env_to_socket%s: skip, too many keys of the same type in a single rule%s: can't open '%s' as rules file: %s%s: reading '%s' as rules file%s: line too long, rule skipped '%s:%u'%s: invalid ACTION operation%s: invalid DEVPATH operation%s: invalid KERNEL operation%s: invalid SUBSYSTEM operationclass%s: '%s' must be specified as 'subsystem' please fix it in %s:%usubsystem|class|bus%s: invalid DRIVER operationATTR{%s: error parsing ATTR attributeID%s: invalid KERNELS operationBUS%s: invalid SUBSYSTEMS operation%s: invalid DRIVERS operationATTRS{SYSFS{%s: invalid ATTRS operation%s: error parsing ATTRS attributedevice/%s: the 'device' link is deprecated and will be removed from a future kernel, please fix it in %s:%u%s: do not reference parent sysfs directories directly, that may break with a future kernel, please fix it in %s:%uENV{%s: error parsing ENV attributePHYSDEVPROGRAM%s: invalid RESULT operationIMPORTprogramfileTESTRUNignore_errorWAIT_FOR_SYSFSLABELGOTOall_partitionsignore_removeOWNER%uGROUPMODEOPTIONSlast_ruleignore_devicelink_priority=string_escape=nonereplace%s: unknown key '%s' in %s:%u%s: PHYSDEV* values are deprecated and will be removed from a future kernel, please fix it in %s:%u%s: realloc failed%s: invalid rule '%s:%u'.rules%s: could not read '%s': %sudev_rules_initparse_fileadd_to_rulesadd_rule_key_pairget_key_attribute%s: specified group '%s' unknown%s: error resolving group '%s': %s%s: specified user '%s' unknown%s: error resolving user '%s': %s%s=%s%s: unable to open '%s': %s%s/%serrinfodebuglookup_grouplookup_useradd_matching_files\x2f\x5ctrueyes1%s: chown(%s, 0, 0) failed: %s%s: chmod(%s, 0000) failed: %s%s: unlink(%s) failed: %s%s: rmdir(%s) failed: %sunlink_securedelete_pathę x <\` Y 8 X@hAaeabi5TE udevd@Nk.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink | `! Y) @@2 XX ;xx6ALL4G<M<:UXwX_\\k``wdd|hh88<xp+ 7070701002ECC080000A1FF00000000000000000000000147CEFAFA0000000E000000080000001100000000000000000000000D00000000sbin/swapoff../bin/busybox070701002EC8B0000081ED00000000000000000000000147CEEB6100004640000000080000001100000000000000000000001000000000sbin/udevsettleELF(4B4 (4444848@@@  @ @ @Qtd/lib/ld-uClibc.so.0C'% ;5@&1B6>3"-?:  $* +)A< /9842,=.! #(07((48@X(L 4X00=d0DANpIU|L \0eL lAAs00yČ0Ќ܌`8X PIP H$00ı0 <H4T`0lx,XA&d .<5̍ I=؍DHMATTAI[$lHu z ,`8DAP\8h0t,memcpyabortlibc.so.0strcpystrerrorgetopt_longsnprintfmunmap__ctype_bgetenvusleepreadlinkmallocoptargrmdirchownstrncasecmpchmodfstat64strtolstrrchrstrstrreadopenlogstrlcpycloselogstrncmpstrncpyunlinkstrcasecmpreaddir64memcmplstat64__uClibc_mainstrtoullmemsetstrlcatopen64opendirstrcmpgetpwnamstderrmmap64__errno_locationgetgrnamatoivsyslogstrlenstrchrfputs__data_startclosedirmkdirclosefree__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__AAA3@@@@@@A A A A AAAA A$A(A,A0A4A8A 1bB@000 P R0N 0 =R0000 `"Q@@rP; `H9P,I .P,>/7!P00X: `P ,\"T/P H0pL (0rߍ(A0EHCEC`p`A(8A-VMMLP`,p,,,1@P4 @l1TPPM /,0l0PP@P:%: S ,j@P@D.V. 0/hC }PO"! S   `P{,o@T T V. 0 hCO,BZߍۍGAA-MLP,s,{ ,P `#; 04B`| ?P l 0f@(P 00T/@4 V RۍGxUUUUO-Mp, `23P PLi & - P    XP LiH   pP-,:0Pq Li `    yPK t  d5Li@  8   WP)      BP      -P 3: Si  ߍGȵص@- p@MP,`hT ,bV  ,[/*P O,Q !S00 0SH0`^@0Q00 ,Ѝ@6ЍAA-PPMM"  P  P t P ` P L P 8 PK@@D,/0S3PP P3k``FU L,,P8: S]PP PH3UA 4`P  # O0@DAJ P,,, ,_PHچ>0 0h8B /q9h {pP O,/PpS U$ hP K  `pP,y,,} ,!P5چ. 0hxC /6P()1P L 5Pd $ -P/0  "P /0P,5O@D,/,7,3 ,Pچ>0 0/h8B P  ,D0P ``0PhЍۍصAG ȵ@-PM`U: p,  /P @/ P- P  P /0P P P /P P , D,  =P @ Pߍ (00@-PMP @TЍ0-\MCP,L @/00,(0( 0 0 Ѝ8GHAA0@-@  0 0x00@X0 \T0@  40 0,00@0 \A Ap@-M@[00`YPP0\\@@  \ 0 ЍpP0xp@-M@500`*PP0\\@@  \w 0 nЍp蠶@0@-MP@  00 0(00"@\ Ѝ0 E-P M` pP PU@@P0P tr 00 l020P@@0P ЍA-@`pPP @TXP PPUX@P ,0P@@0G-MP`P !0 'h@P 0S #S.Spp X. =P lP < 0   ryߍP@-M @00S X P D'P 0!P @P Ѝ (A-p?@`PP00=S  D0 0800<@PT  0 S/0S/0S/0S/0S/0S/@-@PM P J0 SER0@S?ꀪ 0  0 0 0 0 0S"?0#\R R0R0R0r00SR >06 S ] /.udev/queue%s: queue is empty%s: timeout waiting for queue/.udev/uevent_seqnum%s: udev seqnum = %llu/kernel/uevent_seqnum%s: kernel seqnum = %llu%s: queue is empty and no pending events left%s: queue is empty, but events still pendingtimeouthelpmainth/dev/etc/udev/udev.conf/etc/udev/rules.dUDEV_RUNUDEV_CONFIG_FILE%s: can't open '%s' as config file: %s%s: line too long, conf line skipped %s, line %dudev_rootudev_rulesudev_logUDEV_ROOTUDEV_LOG%s: error parsing %s, line %d:%dparse_config_file../subsystem/subsystem//bus/module/module/drivers/drivers//devices//class//block//subsystemblock/bus/driver/class/block/deviceSYSFS_PATH/sys%s: specified group '%s' unknown%s: error resolving group '%s': %s%s: specified user '%s' unknown%s: error resolving user '%s': %s%s=%s%s: unable to open '%s': %s%s/%serrinfodebuglookup_grouplookup_useradd_matching_files\x2f\x5ctrueyes1%s: chown(%s, 0, 0) failed: %s%s: chmod(%s, 0000) failed: %s%s: unlink(%s) failed: %s%s: rmdir(%s) failed: %sunlink_securedelete_path  X@@P  @t\ @AAAAAaeabi5TE udevsettle4p2.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink   0!PP ) \\ 2 tt ; 6 lA#GXX2Mhh2U008_@@k@@w@@| @ @@@AAAA pAAA070701002EC810000081ED00000000000000000000000147CEEAF000000BA0000000080000001100000000000000000000000E00000000sbin/runlevelELF(Ȅ404 (444\\\\\hhhQtd/lib/ld-uClibc.so.0#    \LoX\hXtaX`&\ZȄP/8X\{Xv\FKTPabortlibc.so.0printfputsgetutentutmpnameendutent__uClibc_mainexitsetutent__data_start__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__,048< @ D HL -L-ȂƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ  --- 048GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/X-(M0 S R/Ѝ/d-PM0S PTЍ <?R#̠ࠡN  N lPH -L%c %c unknown\@ 8 4\`@  HhHHHHHHHHHAaeabi5TE runlevelnknK.shstrtab.interp.hash.dynsym.dynstr.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  P!@@) H288-HH8Ȅl>44D2HHLXXV\\b``nddshh|  0PPXXpXs070701002ECC1B0000A1FF00000000000000000000000147CEFAEE0000000E000000080000001100000000000000000000000B00000000sbin/klogd../bin/busybox070701002ECD480000A1FF00000000000000000000000147CEFAF90000000E000000080000001100000000000000000000000B00000000sbin/rmmod../bin/busybox070701002ECE120000A1FF00000000000000000000000147CEFAFD0000000D000000080000001100000000000000000000000A00000000sbin/halthalt.sysvinit070701002EC886000081ED00000000000000000000000147CEEAF000002614000000080000001100000000000000000000000E00000000sbin/killall5ELF(T4|"4 (444||    Qtd/lib/ld-uClibc.so.0_:&94%8 !(3#75-62.'/ ,0 "+$1 )* \h(XtL 0rx!)006L =!!D!KdxS4Ȋ`dԊPW0l0q!!xFTP }(440@0L(Xd !p$|00 !@ċ!Ћ ܋X~!y!$ % * 2`9$@!M0V<_H,abortlibc.so.0putcharstrcpysnprintfgetpidfgetsmallocoptargopterrreaddir__fgetc_unlockedstrrchrkilloptindwaitsignalopenlogcloselogstrncmpforksscanfexecv__uClibc_mainfopengetoptgetsidfclosegetppidopendirstrcmpttynamefgetcstderrfputcstat__errno_locationexitatoivsyslogstrlenstrchr__data_startclosedirvfprintffree__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__! ! !!+      ! ! ! !!!!! !$!(!,!0!4!8!B !@ 0,0`X)"P$P0S ~P/P0 0 PoP/P00P,ꀜ!؜@XpO-d2 ,M`pP $   0"p# sPf ?Pe oPUx@P` Pf( \xP!00p@da` `V@3`p 3pP  # g@P  U [ P  U  R00Z! hH@P  Q @ V,Ѝ|(AP A Hk4 d!!Н!!؝@-`M/P?|AP0000 CPgPF U p U 0-SnpP6W4''$ !@@"P(4`P@T,@T U $ V (\,@TЍЍ@&!!! -L%s: only one argument, a signal number, allowed/proc/versioncannot fork/sbin/mount/bin/mountcannot execute mountmount returned non-zero exit status/proc not mounted, failed to mount./proc unavailable.out of memory/proccannot opendir(/proc)/proc/%s/statrcan't get program name from %s %*c %*d %*d %d %*d %*d %*u %*u %*u %*u %*u %*u %*u %*d %*d %*d %*d %*d %*d %*u %*u %*d %*u %lu %lucan't read sid from %s /proc/%s/cmdline/proc/%s/exeinvalid options on command line! omit pid buffer size %d exceeded! %PPIDillegal omit pid value (%s)! ho:sx%dpidof@(#)killall5 2.86 31-Jul-2004 miquels@cistron.nlmount-tprocHPXX̌ 8 h  t   PȈ  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHAaeabi5TE killall5LT.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink l tt!) Ȉ 2 P;88 6HH ATT GhhMxxUxx_  k  w  |    !! !!(p!!!070701002ECC850000A1FF00000000000000000000000147CEFAEF0000000E000000080000001100000000000000000000000E00000000sbin/loadkmap../bin/busybox070701002EC7F00000A1FF00000000000000000000000147CEFAEA0000000E000000080000001100000000000000000000000D00000000sbin/hwclock../bin/busybox070701002EC887000081ED00000000000000000000000147CEEAF100002348000000080000001100000000000000000000001300000000sbin/halt.sysvinitELF(44 (444$$$$$000Qtd/lib/ld-uClibc.so.0j:0, %# '1 )&2*8 -5.476!9 ($3/ "+T&0.0o 7>̊ D؊dKQXa4ha `p 0v,P~80D0PD\0QP ht4,(<0ȋ ԋ$  '(0{v.4@d3Lp;XBdKXp|0memcpyabortlibc.so.0ioctlgetutidgeteuidsnprintfgetenvfgetsperrorsleepoptarggetutentsocketreaddirunamestrrchrfprintfkillrebootchdiroptindendutentstrncmpstrncpysyncexecv__uClibc_mainstrdupgettimeofdayfopengetoptmemsetfcloseopendirstrcmpstderrpututlinefwriteaccessexitupdwtmpstrchrsetutent__data_startclosedir__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__ ,  $ ( , 048<@DHLPTX\`dh l!p"t#x$|&'()+-./2345689 -L-倓Ə ʌƏ ʌxƏ ʌpƏ ʌhƏ ʌ`Ə ʌXƏ ʌPƏ ʌHƏ ʌ@Ə ʌ8Ə ʌ0Ə ʌ(Ə ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌxƏ ʌpƏ ʌhƏ ʌ`Ə ʌXƏ ʌPƏ ʌHƏ ʌ@Ə ʌ8Ə ʌ0  --- 0Ԙ`GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/-(M0 S R/Ѝ/,0@-Qt0$M 000 QTT0    0 8 x ,u $r @xh0@-M+P p'P Ѝ0/P 0S4@4PC0 3 /긚Țؚ@-`M@pRPP0 0* 0J/ 0E 0@- 0;$ 0p6' 0`1,(P 00: 4%X Pؙ(O-PM/`P0000@pP @ pp\"p d0@SK긐T`hp|!p@PV kkPK0PsP3 00 T&@p(Z7[3X/T<   @(>p[ @ 0@40P6P U4\0` ?|U ?=7h71XL/D,`hxhgE#ͫ#!CO-M M PF;J+8PE(K⢂Ppb@U PpWPZ > Ѝۍp3WP: $0Pl `P xt0\ 0PL4 0((  (E-M`P@B` @P P # P0!h@P  ePd P@ k@P P$ ?Z A@T+ PoA0T0?U0S  > :@PP /P A0T0?U0Sߍf0D P ?ZzxE-pM@P`[bP- !<0 "B;ύ m`Q ( @P,u  8BߍG-pPM`HS2 @ CP b- &@;ύ `ጡm U  V U Q  0Pߍ_@ -{P @   -L [-p]usage: %s [-n] [-w] [-d] [-f] [-h] [-i]%s -n: don't sync before halting the system -w: only write a wtmp reboot record and exit. -d: don't write a wtmp record. -f: force halt/reboot, don't call shutdown. -h: put harddisks in standby mode. -i: shut down all network interfaces. -p: power down the system (if possible, otherwise halt). shutdown-tnow/sbin/shutdown/etc/shutdown/bin/shutdownINIT_VERSIONRUNLEVELWARNING: could not determine runlevel - doing soft %s (it's better to use shutdown instead of %s from the command line) haltrebootpoweroff:ihdfnpwt:%s: must be superuser. /-r-h~~@(#)halt 2.86 31-Jul-2004 miquels@cistron.nlifdown: socketSIOCGIFCONFshaperloifdown: shutdown @(#)ifdown.c 1.11 02-Jun-1998 miquels@cistron.nl/proc/idehd/proc/ide/%s/mediardisk /dev/%s@(#)hddown.c 1.02 22-Apr-2003 miquels@cistron.nl/var/log/wtmp/var/run/utmp ` Ԙ$(@  X0ppppppppppppppppppppppppppppppppppppppppppp@Aaeabi5TE halt.sysvinit'E.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  !@@) 2  X;`` 6pp A L GԘM8U _$$k((w,,|00p070701002ECC9A0000A1FF00000000000000000000000147CEFAEF0000000E000000080000001100000000000000000000000B00000000sbin/lsmod../bin/busybox070701002EC7D6000081ED00000000000000000000000147CEEA29000049A0000000080000001100000000000000000000000E00000000sbin/ldconfigELF(4F4 (444BBBBB,CCCQtd/lib/ld-uClibc.so.0CF @+;9&.#75! CA:68)=?3>$0"/B< ED2*' -14, %( (0L(E 8) 108,EEBȋ0NԋT0]L dHk0E(Erz8E(d4`@8L0XPd0pX|0(0D?D@DBDCDDDE -L-\Ə ʌ\Ə ʌTƏ ʌLƏ ʌDƏ ʌ<Ə ʌ4Ə ʌ,Ə ʌ$Ə ʌƏ ʌƏ ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ|Ə ʌtƏ ʌlƏ ʌdƏ ʌ\Ə ʌTƏ ʌLƏ ʌDƏ ʌ<Ə ʌ4Ə ʌ,Ə ʌ$Ə ʌƏ ʌƏ ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ  --- 0\\GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF@-,@, 0SR/00@/DE-@0MS88/00 0S R/Ѝ/HEC-0M 0S@E0p@-`4P0@.(0( A p@(E@EdE-p@-MPPq@TPT`@ <<0RP@ 0 Ѝp@Ѝ/`@E (-@- M @ 0H@E-- M  0 ЍЍ/@EE-AM$MR刢 ``F P PPc'PP_ :40 pp`l   PU PY @ P1\%~ P@ v0Q,8TTtxjp@ e  `Q*4fdЍڍ8X00,Q!  I0Bp@ 0[ V P h L@' 0|BP@ 0L6e|EDp0@` @xXO-(dM,M 0S,Ѝڍ T(K P (I V 0P ipPQß ʍ Z8#,T <*  P 8@ 00(PUs `` 1@@@,`*V` ("4$ 0 0("4$ 0 0("4$ 0$0   P @~ 0(PUŸPU. @ @ 0T @a 0|@ @T @K 0\fPUP) icP aP9 @1 0L/PC @% 0@;@ 06@ 0,@ 0d""uP@ 04E|EDHEEȾPh@-@P @-4@P 0@-0 AMM P@\Ѝڍ0 PP 5J,, 0@ ,  0S #S 0S S|ED0@- M 00- @ T' P U@ 000 0U P U@a Ѝ0``,E0@-@MP P/ Ѝ0r/@nЍ0@@-@PM M0 p C@pK HP `Q P@ЍڍPQPQ P@EEG-MM:@0` ʍ0`F0q0P 00H\0PE  0V PT @A PQ y GP# hP X\PH1D1D1  <ЍٍP!)0 ^ )XP&X0 S\  Rd 0\P P  l TD|<x|EtElEp`0X HO-M @n[` 00XPP @Ѝ PK@ 0Php$ @ Rah^Yv $ U*$ 8㞑# @SN^* f 04P# Pq? XP 4@^4c8ğ`VP ̠`p<(4ldH ̠|"$$DČ.,!L%X @l%( dP0!B$@@$ ~T0sX!" 0P"$$ 帓( "D < , $4 )D0"Cu@`D8&.$*" 0Rb\   R Q`p("4 \L̠ČT&L'l 0!S $HL`0 0@: @V0L V0E p% Td`p\C? $PH`^pl`F1Q PP R0 0R0QaY D -  Q^[00S! [ >W0W0PP0%PQP&@" 0% QP`8.#$L|̠t%<&$@ 0 F꠿EDпO-Mp@[` 00L@PP @Ѝ Kl@< 0Pp$ l4  RfYPPUPk $@$PY* 2STP `f0(`,4< <qJ X`0`4,  P,Z\`PH̠$4` 0L@̠0̠(P`L\l 0T0 D40 `( , %s %s~can't unlink %s~ (%s)can't create %s~ (%s)can't write %s~ (%s)can't close %s~ (%s)can't chmod %s~ (%s)can't rename %s~ (%s)out of memoryr%s/%scan't resolve %s in chroot %scan't stat %s%s is not a symlinkcan't unlink %scan't link %s to %s (SKIPPED) (changed) %s => %s%s %s does not match type specified for directory!%s appears to be for multiple libc's.so/%s%s%sskipping %s%s is not a regular file or symlink, skippingrbcan't read header from %s, skippingELF/* GNU ld%s is not a shared library, skipping%s is not an a.out library, it's ELF!%s has inconsistent soname (%s)%s is not an ELF library, its an a.out DLL!mixed byte-order detected, using host byte-order...Out of memory! //%s: DvqnNXlpf:C:r:couldn't chroot to %s (%s).couldn't chdir to / (%s)%s: uClibc version %s%s%s is not a shared library/lib/usr/lib:, You should remove `%s' from `%s'libc.so.0libm.so.0libdl.so.0libc.so.5libm.so.5libdl.so.1libc.so.6libm.so.6libdl.so.2h \ BC4  C0Cllllllllllllllllllllllllllllllllllllllllllllllllllllhxld.so-1.7.0Aaeabi5TE ldconfigLV p.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink , 44`!)  02  ;\\ 6ll A ,G:M2 :UB_BBkCCwCC|CCCCDDt(E(E`p(ECESE070701002ECC930000A1FF00000000000000000000000147CEFAEF0000000E000000080000001100000000000000000000000D00000000sbin/losetup../bin/busybox070701002EC8A10000A1FF00000000000000000000000147CEFADB0000000E000000080000001100000000000000000000000D00000000sbin/sulogin/bin/tinylogin070701002ECC970000A1FF00000000000000000000000147CEFAEF0000000E000000080000001100000000000000000000000D00000000sbin/logread../bin/busybox070701002EC7F10000A1FF00000000000000000000000147CEFAFC0000000E000000080000001100000000000000000000000C00000000sbin/udhcpc../bin/busybox070701002ECD930000A1FF00000000000000000000000147CEFAFA0000000E000000080000001100000000000000000000000C00000000sbin/swapon../bin/busybox070701002ECE290000A1FF00000000000000000000000147CEFAFD00000013000000080000001100000000000000000000000A00000000sbin/init/sbin/init.sysvinit070701002ECABF0000A1FF00000000000000000000000147CEFAE70000000E000000080000001100000000000000000000001000000000sbin/fsck.minix../bin/busybox070701002ECBFB0000A1FF00000000000000000000000147CEFAEC0000000E000000080000001100000000000000000000000E00000000sbin/ifconfig../bin/busybox070701002EC8880000A1FF00000000000000000000000147CEFADB00000004000000080000001100000000000000000000000E00000000sbin/poweroffhalt070701002ECE190000A1FF00000000000000000000000147CEFAFD00000011000000080000001100000000000000000000000E00000000sbin/shutdownshutdown.sysvinit070701002ECCE40000A1FF00000000000000000000000147CEFAF20000000E000000080000001100000000000000000000000C00000000sbin/mkswap../bin/busybox070701002ECBD20000A1FF00000000000000000000000147CEFAED0000000E000000080000001100000000000000000000000A00000000sbin/ifup../bin/busybox070701002EC8890000A1FF00000000000000000000000147CEFADB00000004000000080000001100000000000000000000000D00000000sbin/telinitinit070701002EC8A20000A1FF00000000000000000000000147CEFADB0000000E000000080000001100000000000000000000000B00000000sbin/getty/bin/tinylogin070701002ECBDD0000A1FF00000000000000000000000147CEFAED0000000E000000080000001100000000000000000000000C00000000sbin/ifdown../bin/busybox070701002ECC8F0000A1FF00000000000000000000000147CEFAF00000000E000000080000001100000000000000000000001000000000sbin/mkfs.minix../bin/busybox070701002ECD8F0000A1FF00000000000000000000000147CEFAFB0000000E000000080000001100000000000000000000000D00000000sbin/syslogd../bin/busybox070701002EC79C000041ED00000000000000000000000A47CEFADA00000000000000080000001100000000000000000000000600000000media070701002EC79D000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000F00000000media/realroot070701002EC79E000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000B00000000media/card070701002EC79F000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000A00000000media/hdd070701002EC7A0000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000A00000000media/net070701002EC7A1000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000A00000000media/ram070701002EC7A2000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000900000000media/cf070701002EC7A3000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000C00000000media/union070701002EC7A4000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000B00000000media/mmc1070701002EC7A5000041ED00000000000000000000000347CEFADB00000000000000080000001100000000000000000000000400000000lib070701002EC7D70000A1FF00000000000000000000000147CEFADA0000000F000000080000001100000000000000000000000F00000000lib/librt.so.0librt-0.9.29.so070701002EC7D8000081A400000000000000000000000147CEEA2700002AC7000000080000001100000000000000000000001400000000lib/libdl-0.9.29.soELF(4 4 (444ppphh؞؞Rtdhh%'% ! "$ &   #LLB |c '$L `t{TUX:p `I0/!p`j$LQ|j Po v,dlerror_dl_error_numberdladdr_dl_map_cache_dl_loaded_modulesdlinfofprintfstderr_dl_symbol_tables_dl_handlesfree_dl_run_fini_array_dl_debug_addr_dl_errnodlclosedl_cleanupdlsym_dl_find_hashdlopengetenv_dl_load_shared_librarymalloc_dl_unmap_cache_dl_fixup_dl_protect_relro_dl_run_init_array__dl_ldso__ld-uClibc.so.0__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__libdl.so.0ĞȞ̞ОԞ !  ğ ȟ ̟Пԟ؟ܟ$&-(Ə ʌ(Ə ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌD-440 \  0 耗<O-`M` L1 RL VX? Q< RX> $@ @ PT@Q4 (pPQ 82  V:R00^0SPQ pW^  00 2 PЍ R0HE-DDQD @My,1 @T q` 00 b @TP @ W@T p 0N@TPPU X0ppt` >@ 08@TPUЍ輕T(xH@x@XxxxLxO-XX M 0` P 80S V  V 0 R#  Ѝ V R 0000 1S C @Tk 2PP@Q!B !PZppW^ Y 1w Q  Q Rp0 @^1 Q[p ph0P @T0UB S UT R 0U \   @T U1@P UpWp@ @T @ R PU  5/0@ @5/fd 0R 00P0001Sp R 1/| $`@@L<HPDD-880M  @T @TЍ踐LpD-0PM P) p+ 1 P$ ! R P P  R 00Ѝp\  0P t0 ```V @ T 0R @ 0S R:0l@L< -8LppCI2QppYe<r؞{X $p$ = #* (,Xpp   ؞    T, `   $  #P  P     $ ` p  .7؞@ p  VLayL |$L `tT)1Cp O`]0eop`$LP ,libdl.c$a$ddl_error_namestypedo_dlcloseinterp.c_DYNAMIC_GLOBAL_OFFSET_TABLE_dl_cleanup_dl_load_shared_librarydlerrordlinfo__exidx_endgetenv_bss_end___dl_unmap_cache_dl_error_number_dl_run_init_arraymalloc_dl_protect_relro__bss_start__dladdr_dl_run_fini_array__exidx_startdlclose_dl_symbol_tables__dl_ldso___dl_find_hashfprintf_dl_errno_dl_loaded_modules__bss_end___dl_map_cachedlopen_dl_handlesdlsym__bss_start_dl_debug_addr__end__stderr_edata_end_dl_fixup__data_startfree070701002EC7D90000A1FF00000000000000000000000147CEFADA00000011000000080000001100000000000000000000001100000000lib/libutil.so.0libutil-0.9.29.so070701002EC7DB000081A400000000000000000000000147CEEA2700001AD2000000080000001100000000000000000000001400000000lib/librt-0.9.29.soELF(t4t4 ( 444  LLLLLLRtdLLL    t&x4N@ }t/C XL 8 8^`   .s|: 4 f$< $ p 8; 1h0,mq_close__errno_locationmq_getattrmq_setattrmq_notifymq_openmq_receivemq_timedreceivemq_sendmq_timedsendmq_unlinktimer_createmallocfreetimer_deletetimer_getoverruntimer_gettimetimer_settime__dl_ldso__libc.so.0__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__librt.so.0 -夊ƏʌƏʌƏʌƏʌ@-Ep pp0g0 @-0QEp 0S  pp က g & -@-0 M/S@p  ~ 0p pp  Ѝ@ Ѝ/ 8#( g @-EMp@ p@Ѝ␀0d0- M Ѝ@-M@E p@Ѝ␀0d0- M Ѝ@-0~/Sp pp Pကd \ က\ W g A-@QHM @0@00P`SHЍ@P |pD  pPp D  .e0@-A0p ppP   က0g 0@-A pp 0g0@-|p pp0g0@-|p pp0g0/lib/ld-uClibc.so.0B M  oL0000GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2Aaeabi5TE.symtab.strtab.shstrtab.hash.dynsym.dynstr.rel.plt.text.interp.dynamic.got.comment.ARM.attributes! )M1  500D:tt4@ HLLQV_po- |V0t L    t x + 5 B $L |X g v   8  p L$<x4@ 0@ D x4@$ 0=tFQ\ gXtL {8 8`  | 4$< $ +p 89 AhK0Q,mq_close.c$amq_getsetattr.cmq_notify.cmq_open.cmq_receive.cmq_send.cmq_unlink.ctimer_create.ctimer_delete.ctimer_getoverr.ctimer_gettime.ctimer_settime.cinterp.c_DYNAMIC__GI_mq_timedsend__GI_mq_setattr_GLOBAL_OFFSET_TABLE___GI_mq_timedreceive$dmq_setattrmq_timedreceive__exidx_endtimer_createmq_close_bss_end__mq_receivemq_getattrtimer_deletemalloctimer_gettimemq_send__bss_start____exidx_start__dl_ldso____bss_end__mq_unlink__bss_start__end__timer_getoverrun_edata_endmq_timedsend__errno_location__data_starttimer_settimemq_openmq_notifyclosefree070701002EC8CB0000A1FF00000000000000000000000147CEFADB00000016000000080000001100000000000000000000001600000000lib/libvolume_id.so.0libvolume_id.so.0.80.0070701002EC7DC000081A400000000000000000000000147CEEA2700003ED5000000080000001100000000000000000000001700000000lib/libcrypt-0.9.29.soELF(p404 (444&&&&&@/@@@/@@Rtd@/@@   p-(g& Y&C&<(%4 p<$4n`s setkeyencryptmemsetmemcpystrlenstrncmpstrcpystrncatstrcat__dl_ldso__libc.so.0__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__libcrypt.so.0  -Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ0 $S 01S0$S0zP `P;@/ZP@P5@/9P-P.@//O-襟\M 0Sq UеЕЅ%uE` 0P0 ```` ` 0 " ` `@\PUX㉳@`P Fታ0   00 @P P@UYtDTp@ K   @R4d @p G 8RdX$ PE0QH0 4~]   ~G [~ ~ 7Ì~  ~O Qό @P!P0!   Jʠ$:, P: V "F*@0 PQA!4 ȔPpG@w0) `pFwp)Gq +Ǡ`/  +p +S4 0)L)1T@@ _q  ˋ@`˂ K00`L  @0T `@`!  L p P8{ [ 0 H0dЍDDn pX\p#llCc\D-llpM 0@P `` 0 00Q^@lЍuG-䠟䀟M pD0P@ `` 0 00Q\ P0Y3 ~`R!0  \`VЍ蜙qO-騡4M@ Pm `00 R@Q`P 4Ѝ@H@Q@S=, (0:P(0,@!!&  0! i?00?0 ?  v $T$ʠ$? ??P?`?p??  P`p $= 0P`p   ꤘ(q@-@R 00 "40 "80  T"<0$0$$ 0 0 /vT2#EgܺD-8R J(0@?0 ! \TvO-lM(@ p l0 T  @^P0 P@$@ P P`0 pK$   p Gb  V .$' AV0 h 1@ b0s΄ 0p@W`  @ P $) ,`0$  00 0@ 0lЍuv\uC-Pp!`R0A0? 0@@b0W>P30M1201* eЍC K?WP0P@@P?? W@@0@-LM@P@p @   `?07S8 c x c  X LЍO-ܣc# M@ @P P0ß0 0S$S R*Q*pW$Wb lp  h d` ^  XP Sǰ  N X @T  @D AT  UX @   2@4P@40 ;1 V  O d U#N!dU(W,   P 7U, Jp  LO d U  N!dU   W  P  U`开 @Pp``pPp  ȁ@ TP   0Ѝ 2PXuxPuVUUU$It./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz@ @ @ @                                                                                                                            :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$ @       $$1$              xjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ    ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz/lib/ld-uClibc.so.0O  د8o@GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2Aaeabi5TE.symtab.strtab.shstrtab.hash.dynsym.dynstr.rel.plt.text.rodata.interp.dynamic.got.bss.comment.ARM.attributes! p)  1 85h:pp @!!PH&&P@@/Yد/(^0c0HlpH0a0|3k ;M p!&@ د     p D p( + @!GD NH Us as ms vs  D"Dt@ @ t@ s@ D$@\8 $8$0$3       C S +c 6  >$ CD I` h ` ( T  (_4@ ht@ q@ z%@  (t ( $( ( !A(!T 0<(\lL l(&A8 (t%t&4%@ (X!0%* 2 :Px FL (4%MV@_kp wد ( (& &&(4p<$ %-49`@ crypt.c$ades.cascii_to_bindes_init$ddes_initialised.1810bits32bits28bits24old_rawkey1old_rawkey0saltbitsold_saltu_sboxsboxm_sboxinv_key_permfinal_perminit_permIPinv_comp_permkey_permcomp_permbits8key_perm_masklip_masklfp_masklfp_maskrip_maskrkey_perm_maskrcomp_masklcomp_maskrun_pboxpboxpsboxsetup_saltdes_setkeyde_keyslde_keysren_keyslkey_shiftsen_keysrdo_desoutput.2370ascii64md5.c__md5_Encode__md5_Init__md5_to64__md5_itoa64__md5_TransformC.2889S.2885P.2890__md5_Update__md5_Final__md5__magicsp.2950ep.2951passwd.2952p.2953interp.c_DYNAMIC__des_crypt__md5_crypt_GLOBAL_OFFSET_TABLE_strcpy__exidx_endsetkey_bss_end__memcpy__bss_start____exidx_start__dl_ldso__strcat__bss_end__strncmpcryptencryptstrncat__bss_startmemset__end___edata_endstrlen__data_start070701002EC7DD0000A1FF00000000000000000000000147CEFADA00000014000000080000001100000000000000000000001400000000lib/libpthread.so.0libpthread-0.9.29.so070701002EC8B1000041ED00000000000000000000000247CEFADB00000000000000080000001100000000000000000000000900000000lib/udev070701002EC8B2000081ED00000000000000000000000147CEEB6000000234000000080000001100000000000000000000001500000000lib/udev/firmware.sh#!/bin/sh -e FIRMWARE_DIRS="/lib/firmware /usr/local/lib/firmware" err() { echo "$@" >&2 if [ -x /bin/logger ]; then /bin/logger -t "${0##*/}[$$]" "$@" fi } if [ ! -e /sys$DEVPATH/loading ]; then err "udev firmware loader misses sysfs directory" exit 1 fi for DIR in $FIRMWARE_DIRS; do [ -e "$DIR/$FIRMWARE" ] || continue echo 1 > /sys$DEVPATH/loading cat "$DIR/$FIRMWARE" > /sys$DEVPATH/data echo 0 > /sys$DEVPATH/loading exit 0 done echo -1 > /sys$DEVPATH/loading err "Cannot find firmware file '$FIRMWARE'" exit 1 070701002EC8B3000081ED00000000000000000000000147CEEB6200002D40000000080000001100000000000000000000001000000000lib/udev/vol_idELF(4)4 (444''''''''Qtd/lib/ld-uClibc.so.0zF / 23<)+$=9 "-@BC.? (*45 D:081E%! >76#A,;'&x4T@LL4~X8.d`p |0BX((b u0ičL Ѝ(܍0ph` $P0<<0H4(((P T0`x0 lx44,$(̎42d ؎<: (BH8K((- 4((R,$c8HlDAP`H\thz(tO 0c,libvolume_id.so.0volume_id_get_type_versionvolume_id_probe_allvolume_id_all_probers__ctype_bmemcpymallocvolume_id_probe_filesystemstrnlenvolume_id_open_fdvolume_id_get_typevolume_id_log_fnvolume_id_get_uuidmemcmpvolume_id_get_labelopen64strcmpvolume_id_closevolume_id_encode_stringvolume_id_get_usagestrlenstrchr_Jv_RegisterClassesfreeabortlibc.so.0ioctlstrerrorgetopt_longgetenvgetuidvsnprintfsetgroupsstrncasecmpstrtolstrrchrfprintfoptindsetgidopenlogstrlcpycloselogstrncmpstrncpystrcasecmpreaddir64__uClibc_mainstrlcatopendirgetpwnamstderr__errno_locationgetgrnamvsyslogfputs__data_startclosedirsetuid__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__( (( (6'''((( (( ( ( ( ($(((,(0(4(8(<(@(D(H(L(P(T("X(#\(%`(&d('h((l()p(*t(+x(,|(.(0(1(3(4(5(7(8(;(<(=(>(?(@(B(D(E -L-帚Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌxƏ ʌpƏ ʌhƏ ʌ`Ə ʌXƏ ʌPƏ ʌHƏ ʌ@Ə ʌ8Ə ʌ0Ə ʌ(Ə ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌxƏ ʌpƏ ʌhƏ ʌ`Ə ʌXƏ ʌPƏ ʌHƏ ʌ@Ə ʌ8Ə ʌ0Ə ʌ(  --- 0 8GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/(-(M0 S R/Ѝ/ '@-@Mb1/P jP ?ЍЀ-0@-h@PM0\s,P00 000 UЍ0@ Ѝ/( G- 3M`PhA`%`5 @<%<5@p$ lP aP hP LP+tP sP%uP xP  @40qW $4@?@PX4 X`P <1.P 01N PP@P 0S 0S P PP 0#YZ @1 0@Y 1^ 0001^ 000fP 3 P P P 2FP P ,Cn0 C2P@P 0R00 0Q # 3002000   000 _ !>  /\!>Q:!.00T,,o(,kXAꄕ@x$p h(`X,PH!@'$2S(  9P!!0S /P ,C0S $P `V@@@@@3ލ0,(80H(x((rh((8P`x0-@-AM@B΍@DP`p 0$$ č 0 @JAލ@Ѝ/p@-M@00`PP0\\@@  \. S0 %Ѝpp@-M@00`PP0\\@@  \ -0 Ѝp00@-MP@  00 0(00@\ Ѝ0 E-P M` EpP PU@@P0P r 00 020P@@0P ЍXA-@`pP5P @TXP )PPU@P ,0P@@0G-MP `P 0 s'@P 0S #S.Spp X. P P < 0   rߍ`@-M @00S X P DP 0P @P Ѝ舦A-p@`PP00=S  D0 0800@PT  0 S/0S/0S/0S/0S/0S/@-@PM P J0 SER0@S?ꤝĝНܝ 0  0 0 0 0 0S"?0#\R R0R0R0r00SR >06 S --export export key/value pairs --type filesystem type --label filesystem label --label-raw raw label --uuid filesystem uuid --skip-raid don't probe for raid --probe-all find possibly conflicting signatures --help %s: no deviceno device %s: error opening volume nobody%s: unable to drop privileges: %s %s: unknown volume type #+-.:=@_/ $%?,ID_FS_USAGE=%s ID_FS_TYPE=%s ID_FS_VERSION=%s ID_FS_UUID=%s ID_FS_UUID_ENC=%s ID_FS_LABEL=%s ID_FS_LABEL_ENC=%s ID_FS_LABEL_SAFE=%s raid%s:%i %slabellabel-rawuuidtypeexportskip-raidprobe-allhelpmainФlؤLutxsa h%s: specified group '%s' unknown%s: error resolving group '%s': %s%s: specified user '%s' unknown%s: error resolving user '%s': %s%s=%s%s: unable to open '%s': %s%s/%serrinfodebuglookup_grouplookup_useradd_matching_files\x2f\x5ctrueyes1,n  ''p  'xX ' Aaeabi5TE vol_id G'.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  `!pp) XX 2 xx ; 6 xAtG "M "U'_''k''w ' '|''''(( ((p(( (070701002EC8B5000081ED00000000000000000000000147CEEB6200006024000000080000001100000000000000000000001100000000lib/udev/scsi_idELF(44\4 (444WWWWWWWWQtd/lib/ld-uClibc.so.0G=*(@: 26EF;B%1C? ' #/.DA 48>570 -3$ !9+&"),<(T<ČL%Ќ8܌X. :0CPI[S  ^Z0a$0 g<0pHuTL |[[`lx`P,[ ^4P H0̍`0 ؍40  ,,08X#D+P[9\@d Hht<O ^W^Hg4o[^v$ȎԎH`YI0,( memcpyabortlibc.so.0strcpyioctlstrerrorgetopt_longsnprintfmknod__ctype_bgetenvgetpidfgetsreadlinkputsmallocoptargstrtoulstrncasecmpstrtolstrnlenstrrchrcallocoptindstrstrreadopenlogstrlcpycloselogstrncmpstrncpyunlinkstrcasecmpreaddir64memcmpsscanflstat64strncat__uClibc_mainmemsetstrlcatfcloseopendirstrcmpgetpwnamsprintfstrsep__errno_locationexitgetgrnamvsyslogstrlenstrchr__data_startclosedirfreefopen64__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__[ [[XXXXXXXX X X XXXXXXXXXYYY Y Y!Y"Y$Y% Y&$Y'(Y(,Y)0Y*4Y+8Y,pY?tY@xYA|YCYDYEYF -L-Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌxƏ ʌpƏ ʌhƏ ʌ`Ə ʌXƏ ʌPƏ ʌHƏ ʌ@Ə ʌ8Ə ʌ0Ə ʌ(Ə ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌxƏ ʌpƏ ʌhƏ ʌ`Ə ʌX  --- 0PGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/[-(M0 S R/Ѝ/W0@- MP0"S00`0`0@P H00T000400  0 Ѝ0[p@-@M`P (0S P8( 0  8@440, ) 00BЍp (0@-@MP0 C0@P 0R00 0Q # 3002p 0 00  000 _000 /S0Q:00Ѝ0[-0@-h@PM0\sP00 000 UЍ0@ Ѝ/[0G-`ŸM(p`@  02@lp 2V @P"R|8HHHHHHHHHHH$0PX`HHHHؔHlHHH $H1  t1 l00 ,u01H1 @A,j01 61  P  ~P  xP 00 g0 00,;010 0 000wp_Ѝ[[[[[[Y@[08@[P[[[[[pO-MPPSP 4P@ # 3  P00" @ P@ 0P S2 0"0 00 PR #R `L@P& @P`s<pPy @P P`e.PPk @P `P@PT[ 0!SYR V  PU  uP009 0 R 0R@QP | 0P@0@P0U@ d P v 3U00S @@ЍxY[0E-M M Pp4(P G ,01P 66@,04-  =@ǍP@0Q0P0S ?L0CDp&&P@@,O@D``F8&0`P 60S&ppP0S 5PX< @PY s. s>P0)s.`Ÿ 0xP2 P ,P ,V@a an`Q A\0PP L20@s@3TL82 R" (\ANX@T {M tF|CZ @) =$10S 1 00   Q0Q_S_00a΍ R X10S Ha8@d00S@]@Pߍۍ8@\PX[[`[[(0`h[4\\t\[08@P [[[[[HXhx[[[O-|Mp 0Wr0Pstu vpw 堠0((#@@@ S00 0000r0$0R0(02 @,0@p P"?P<`>P~ 0 ?( "QQ 0 SRP0000Ss S} S{w^U\"0 O0!PP `<0Sg?^!0^( !2`VP.0 ^ nx!0JU \0 P H0 0h8B /R9h _pP O,/PpS U$ LP K  DpP,,, ,P5چ. 0hxC /P()P L Pd $ P/0  P /0P,YO@D,S,[,W ,Pچ>0 0/h8B P  ,6D0P ``0PhЍۍ0@H[\ P` h@-PM`U: p,  /P @/ P- P  P /0P P P /}P P , D,  =P @ Pߍpx0@-PMP @TЍ0-\M'P,L @/00,(0( 0 0 Ѝ@\P[[0@-@  0 0x00@X0 \T0@  40 0,00o@0 \[ [p@-M@H00`IPP0\\@@  \" 0 Ѝphp@-M@"00`PP0\\@@  \ 0 Ѝpx0@-MP@  00 0(00 @\ Ѝ0 E-P M` pP PU@y@P0P Xr 00 P020P@@0P Ѝ A-@`pPP @TXP PPU?@P ,0P@@0G-MPv`P 0 g'L@P 0S #S.Spp X. P VP < 0   rcߍ(H@-M @00S X P D P 0P @P ЍPX`A-p,@`PP00=S  D0 0800#@PT  0 S/0S/0S/0S/0S/0S/@-@PM P J0 SER0@S? 0  0 0 0 0 0S"?0#\R R0R0R0r00SR >06 S --device device node for SG_IO commands --devpath sysfs devpath --config location of config file --page SCSI page (0x80, 0x83, pre-spc3-83) --fallback-to-sysfs print sysfs values if inquiry fails --ignore-sysfs ignore sysfs entries --blacklisted threat device as blacklisted --whitelisted threat device as whitelisted --prefix-bus-id prefix SCSI bus id --replace-whitespace replace all whitespaces by underscores --verbose verbose logging --version print version --export print values as environment keys --help print this help text 0x800x83pre-spc3-83%s: Unknown page code '%s'0.9r%s: can't open %s: %s%s: Can't allocate memory.%s: Config file line %d too long. =VENDORMODELOPTIONS%s: Error parsing config file line %d '%s' scsi_idSYSFS_PATH/sysDEVPATH%s: --devpath= must be specified %s: unable to access '%s'blockdev%u:%u%s: %s: invalid dev major/minor%s/%s-maj%d-min%d-%u/devtmp-scsi%s: mknod failed: %sscsi%s: unable to access parent device of '%s'vendor%s: %s: cannot get vendor attributemodel%s: %s: cannot get model attribute type%s: %s: cannot get type attributerev%s: %s: cannot get type attribute %s: Unknown or bad option '%c' (0x%x)ID_VENDOR=%s ID_MODEL=%s ID_REVISION=%s ID_SERIAL=%s ID_SERIAL_SHORT=%s ID_TYPE=%s ID_BUS=%s %s: , " deviceconfigpagedevpathfallback-to-sysfsblacklistedwhitelistedprefix-bus-idreplace-whitespaceignore-sysfsverboseversionexporthelpabd:f:ghinp:s:uvVxmainget_file_optionsdfpsab g0i@uXnhvpVxxhset_optionsscsi_idcreate_tmp_devset_sysfs_valuesbgp:per_dev_options%s: buflen %d too long%s: %s: ioctl failed: %s%s: %s: called with no error%s: %s: sg_io failed status 0x%x 0x%x 0x%x 0x%x%s: %s: sense buffer empty%s: %s: sense buffer too small %d bytes, %d bytes too short%s: %s: sense result too small %d bytes%s: %s: invalid sense code 0x%x%s: %s: sense key 0x%x ASC 0x%x ASCQ 0x%x%s: %s: old sense key: 0x%x%s: %s: sense = %2x %2x%s: %s: non-extended sense class %d code 0x%0x%s: %s: Unable to get INQUIRY vpd %d page 0x%x.%s: %s: cannot get model attribute%s: %s: expected length %d, got length %d%s: %s: Invalid page 0x83%s: %s: length %d too short - need %d%s: %s: Invalid page 0x80%s: %s: cannot open %s: %s%s: %s: unsupported page code 0x%d%s: %s: page 0 not available.%s: %s: page 0 buffer too long %d%s: %s: invalid page0 data%s: %s: close failed: %s%xscsi_get_serial0123456789abcdefdo_scsi_page83_prespc3_inquiryscsi_inquiryscsi_dumpscsi_dump_sensedo_scsi_page0_inquirydo_scsi_page83_inquirycheck_fill_0x83_idprepend_vendor_modeldo_scsi_page80_inquiryscsi_std_inquiry../subsystem/subsystem//bus/module/module/drivers/drivers//devices//class//block//subsystem/bus/driver/class/block/device%s: specified group '%s' unknown%s: error resolving group '%s': %s%s: specified user '%s' unknown%s: error resolving user '%s': %s%s=%s%s: unable to open '%s': %s%s/%serrinfodebuglookup_grouplookup_useradd_matching_files\x2f\x5ctrueyes1ȏ WW0  X؊W/etc/scsi_id.config[[[[Aaeabi5TE scsi_id-L.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink ( 00p!)  2 ؊ ; 6 A448GGMHUW_WWkWWwWW|WWXXYY [[p[[ [070701002EC7DE0000A1FF00000000000000000000000147CEFADA00000013000000080000001100000000000000000000001300000000lib/ld-uClibc.so.0ld-uClibc-0.9.29.so070701002EC7DF000081A400000000000000000000000147CEEA2700001A48000000080000001100000000000000000000001600000000lib/libutil-0.9.29.soELF(L44 ( 444  Rtd%+'  &* )$ !"  #%(L(bT~ J 90 h0; ( ` 'mT x|I\R@ 0L0/Uw H(,dp0 [080forkptyforkclose_exitloginmemcpyutmpnamesetutentgetpidstrncpypututlineendutentsetsidioctldup2login_ttylogoutgetutlinememsetgettimeofdaylogwtmpupdwtmpgetptgrantptunlockptptsname_ropentcsetattrstrcpyopenpty__dl_ldso__libc.so.0__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__libutil.so.0   ďȏ̏Џԏ؏܏"#$%&()*-lƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ0@-M0 P 0 p@Ѝ0p@ P 'P  00D-haM @- L @;  aߍ褆|@-@ p0s vspT000D-鼠P Mdp@ "B; ͍` F@P , a,L]UW\P@ Fݍ0@A갅|D-鰠M@ P`- ?T p 0 S Nˠ  % ,! LU  1ݍ |K-MMpP`p@ PP "Ѝڍ * P p V  *( R   U@  /var/run/utmp/var/log/wtmp/lib/ld-uClibc.so.0]< j XoGCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2Aaeabi5TE.symtab.strtab.shstrtab.hash.dynsym.dynstr.rel.plt.text.rodata.interp.dynamic.got.comment.ARM.attributesH! <<)j1 XX54:LL@2` ` H PYl^~gp~w$ `<XL`       L L  T %  . X 8 ` BKTT xcy`  ( ,(T  0 0 ( ` T x|*\3<D0ILQ0^jqy ,dp 080forkpty.c$alogin.c$dlogin_tty.clogout.clogwtmp.copenpty.cinterp.c_DYNAMIC__GI_login_tty_GLOBAL_OFFSET_TABLE___GI_openptystrcpyioctlgetutline__exidx_end_bss_end__logwtmpgetpidmemcpydup2__bss_start____exidx_startgetpt__dl_ldso__openptyutmpnamelogin_ttylogin__bss_end__unlockptendutentstrncpyforkforkptygettimeofday__bss_startmemsetgrantpt__end__logoutpututline_edata_end_exitopenptsname_rupdwtmpsetutent__data_startsetsidtcsetattrclose070701002EC8CD000081ED00000000000000000000000147CEEB6200007E5C000000080000001100000000000000000000001B00000000lib/libvolume_id.so.0.80.0ELF(84z4 (uuu(PxQtdCNGD # CHL=2E-? K"(J;8@F95>B<:I7*M13'.  !+&,0%64/A $)$(1-Jm,)4IJKG$ Z4/ 4 ]`FS80+\Z,4t/HR z;">L .`R L]<"i#RL[%,]<_MTZ4$?LA0X_J89QY4~,uR 9dY@T\E%0Y4`<dYH X%4H]8g0^(Vd< R{ Z40&$eT;C```*$B I'LYU!0',__cxa_finalize_Jv_RegisterClassesvolume_id_probe_extsnprintfvolume_id_log_fnmemcpy__ctype_tolowervolume_id_probe_vfatmemcmpstrcpyvolume_id_probe_hfs_hfsplusvolume_id_probe_highpoint_45x_raidvolume_id_probe_highpoint_37x_raidvolume_id_probe_intel_software_raidvolume_id_probe_lsi_mega_raidvolume_id_probe_via_raidvolume_id_probe_silicon_medley_raidvolume_id_probe_nvidia_raidvolume_id_probe_promise_fasttrack_raidvolume_id_probe_adaptec_raidvolume_id_probe_jmicron_raidvolume_id_probe_ddf_raidvolume_id_probe_iso9660volume_id_probe_jfsvolume_id_probe_linux_raidvolume_id_probe_linux_swapvolume_id_probe_lvm2volume_id_probe_lvm1volume_id_probe_ntfsvolume_id_probe_reiserfsvolume_id_probe_udfvolume_id_probe_ufsvolume_id_probe_xfsvolume_id_probe_cramfsvolume_id_probe_hpfssprintfvolume_id_probe_romfsstrlenvolume_id_probe_sysvvolume_id_probe_minixvolume_id_probe_gfs2volume_id_probe_gfsvolume_id_probe_luksvolume_id_probe_ocfs2volume_id_probe_ocfs1volume_id_probe_vxfsvolume_id_probe_squashfsvolume_id_probe_netwarevolume_id_get_labelvolume_id_get_label_rawvolume_id_get_uuidvolume_id_get_uuid_rawvolume_id_get_usagevolume_id_get_typevolume_id_get_type_versionvolume_id_all_probersvolume_id_probe_filesystemvolume_id_probe_raidvolume_id_probe_allvolume_id_closefreevolume_id_open_fdmallocmemsetvolume_id_open_nodeopen64volume_id_encode_stringstrchrvolume_id_get_prober_by_typestrcmplseek64readstrnlen__ctype_braiselibc.so.0libvolume_id.so.0  4H\p$(,8<L`t(<Pdx  "@H0DEXlA,>  '4(H\Fp =9%$8 LJ`<t7)GIdhlpt!x#|$*.12468BCDKLM -L-ƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGFD-DD@ 0MS00 R(0/00ЍD/|`tD-000  R 00S/D/p\lD-ȡP1 M@`00T + 00*PPU 9 804`!SO0 $(,;2;C SCx@  h 0? >ML0NOČ 48< Aa` b\0]c$^ (_4\8p L h0= L0004000ЍrrhSrrrrrO-졟M P l@Qk Qe 0 ?0S` R^ 04Z 04V`0 000 Q`p(Y, 0?0S( 0S%0?0 S 0   0p@ 0 P 0 @DT * P000 P0 000 0 P 00 P Pߍ(pO-@M!A4464Ɵ `00& !.@Pv 1USs1Sp Pi RP wP$  pP 6P hP t aP \ ZP 0S0SS< 0407 [4 0SPPSPU, PU) 0E& 0t W W  W W 0$( 4 0! "#48 ,0,$0%& '48$  (ᛒ)@ T,`O4P P ! K3PE 0D  0P ) 0 0 @Pf  k`PL(@   "{ ? T`PX@ > 0S; S+J P  CP  <P(`@ 0 @@H D -P  e  C {[ t  P \i D000LЍurhuuuvv v(v8vD-ࠟP0 M@`000 ) 00 PP  @pP   0  " ,000Ѝ|@vrhHvPvG-4P0010M @p0Ѓ| 0 0A `P0 @PČȌ̌@0\ `     0 4 8?$(,8#4"<040040,000$( 0& 2$ " 0 @ PČȌ̌0`p @P4Č8Ȍ ̌?48<40$( 0 $0!x1 0`  p P @ 0 TD0 0X Hdh l0 \L<|.)4,Ġt%<|&$̌03$ 0$00 0$P $ 0yP * 00$pP<ЍXvshN+vhvO-ԡ1 MP0. p 0 0 `` p@P pP XP  @P  (P  P W㋰5 *000 000000 0_ `P AN @     0  Ѝvrhvvvwvvvwvv,E-錠 M `. P @hP pPL  T  g 000 Ѝ w0wpD-騠P0 M@`01 0+ 00 TP  K@P ,000 Ѝp@@wrhHwPwO-Ȣ,M!A2Ÿ 00l ! RP@ p PH 0Y 01P0 5`4д6@2p 3$ P70[(0 k2 0  P9#A 0P 0P `P$`R 1 `PJ 04 0 $$0 P 4$ @8`< p 0( < ĀL" ` ^ P *s pS 0 P P`S@T@@# 0  H000,Ѝl`wrhrhwrpwO-p2Ÿ M`P0? ( 00Pe 14@  TP>  MPx; p DP\2 T ;P<$@ n  L 0 p 000(* 00P# 4  P00d@ 00A   T 0C R ЍpxwrhwwwwwwwwwwO-) 0M 0 3ß p0K  jP L@ P"KP@ P* P  P  P  P  P  P  0)P 0S+@0P [ P` 00P@ Pp 0 `Sl dP  ]P @U` 4 0@PT 0 4SG0   0 48 P` 0@P P`. 0Ē" 0 48<S\  V M0S ( S 0XD000Ѝwrhxxxxu x(x0xO-鴡1 $M @ `0010 p&@_0 hPP<<06 S w4lk0r\:fd<gM#OUnju&P{b38 *l3 ) }B  2 z cp  gx-` Y0 E l9` ) `) F$ |F H0<\ d t2 T>  HbX $3 P5 L5   (a@ "  34 xH ; (,( |2 4= "$! %7  K?t :h H4T ,$ w ) E$ T3 0 T" @$-@ h0  ) :` L - r d=T 8> m ` L 4 lhb L5 4G 9;8 ; q3\ >D7 :p `) ) |2 <5 ; :ha Zd-t s# DX V" 7$ B0 1 sBX H3 TCX 7>l |) 93 ) z<  >, 7  X>( R0<\ :` =(  u9` 4,( #(a@ ) _D@ p$ h0  <5  7( - |Dx |) ->H JD7 :h .! 4 sx-` E( 147 -ha h; M", V7 `~D iA8 <$ h"_hb 2 U ~H UbX =, :p #>, D5 ZL  8~( A`?H ; _7 X;( u( H4T U@( ; ~  ) H <" <3 D` |H `܊$ .;8 l<T LE` {3\ }$ h; W38 |h@ _<T * d=T \"  $3 t2 N$-@ qX   Cp ) c# = P5 __cxa_finalize_Jv_RegisterClasses__udivsi3__aeabi_uidiv__aeabi_uidivmod__divsi3__aeabi_idiv__aeabi_idivmod__umodsi3__modsi3__lshrdi3__aeabi_llsr__ashrdi3__aeabi_lasr__ashldi3__aeabi_llsl__negdf2__aeabi_dneg__aeabi_drsub__subdf3__aeabi_dsub__adddf3__aeabi_dadd__aeabi_ui2d__floatsidf__aeabi_i2d__extendsfdf2__aeabi_f2d__aeabi_ul2d__floatdidf__aeabi_l2d__muldf3__aeabi_dmul__divdf3__aeabi_ddiv__gtdf2__gedf2__ltdf2__ledf2__nedf2__eqdf2__aeabi_cdrcmple__aeabi_cdcmpeq__aeabi_cdcmple__aeabi_dcmpeq__aeabi_dcmplt__aeabi_dcmple__aeabi_dcmpge__aeabi_dcmpgt__unorddf2__aeabi_dcmpun__fixdfsi__aeabi_d2iz__fixunsdfsi__aeabi_d2uiz__truncdfsf2__aeabi_d2f__negsf2__aeabi_fneg__aeabi_frsub__subsf3__aeabi_fsub__addsf3__aeabi_fadd__aeabi_ui2f__floatsisf__aeabi_i2f__aeabi_ul2f__floatdisf__aeabi_l2f__mulsf3__aeabi_fmul__divsf3__aeabi_fdiv__gtsf2__gesf2__ltsf2__lesf2__nesf2__eqsf2__aeabi_cfrcmple__aeabi_cfcmpeq__aeabi_cfcmple__aeabi_fcmpeq__aeabi_fcmplt__aeabi_fcmple__aeabi_fcmpge__aeabi_fcmpgt__unordsf2__aeabi_fcmpun__fixsfsi__aeabi_f2iz__fixunssfsi__aeabi_f2uiz__aeabi_lcmp__aeabi_ulcmp__aeabi_ldivmod__aeabi_uldivmodraise__aeabi_lmul__muldi3__negdi2__cmpdi2__ucmpdi2__clear_cache__enable_execute_stack__absvsi2abort__absvdi2__addvsi3__addvdi3__subvsi3__subvdi3__mulvsi3__mulvdi3__negvsi2__negvdi2__ffsdi2__clzsi2__clzdi2__ctzsi2__ctzdi2__popcountsi2__popcountdi2__paritysi2__paritydi2__powisf2__powidf2__mulsc3__muldc3__divsc3__divdc3__aeabi_f2lz__fixsfdi__fixunssfdi__aeabi_f2ulz__aeabi_d2lz__fixdfdi__fixunsdfdi__aeabi_d2ulz__divdi3__aeabi_unwind_cpp_pr0__moddi3__udivdi3__umoddi3__udivmoddi4__aeabi_uread4__aeabi_uwrite4__aeabi_uread8__aeabi_uwrite8_Unwind_VRS_Get_Unwind_VRS_Set_Unwind_GetCFA_Unwind_Complete_Unwind_DeleteException_Unwind_GetTextRelBase_Unwind_GetDataRelBase__cxa_begin_cleanup__cxa_type_match__cxa_call_unexpected__aeabi_unwind_cpp_pr2__aeabi_unwind_cpp_pr1__gnu_Unwind_Find_exidxmemcpy_Unwind_VRS_Pop_Unwind_RaiseException_Unwind_Resume_Unwind_Resume_or_Rethrow_Unwind_ForcedUnwind_Unwind_GetLanguageSpecificData_Unwind_GetRegionStart__gnu_unwind_frame__gcc_personality_v0libc.so.0libgcc_s.so.1GCC_3.0GCC_3.3GCC_3.3.1GCC_3.3.4GCC_3.4GCC_3.5GCC_3.4.2GCC_4.0.0      \P&y S&y $a_& $d_& $ T&y $  U&y  b^& $   `Z' *  0@LXd48<D'H3PfT\`  !"(1259=>CK]ghv{|}  $(, -L-ƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGFD-DD@ 0MS00 R(0/00ЍD/D-000  R 00S/D/$ Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/-/@-(@A/Q B aB Q' 00`BS&(   QQ11"1:QQ11 1:S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3/Q!! # 3 Q!! "Q!! "Q \3`B/-`/@-@A/ Q,:P/ QQ11 2:QQ11 2: RP@ P@ !P!@ P@ P! R0 r P@ P@ P@ /-&/Q2 aB`B QP& QQ11 2:QQ11 2: RP@ P@ !P!@ P@ P! R0 r P@ P@ P@ \`B/-/GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF///xGF-,O/xGF8O/xGF DO/xGF-hO/xGFtO/xGF O/xGF-O/xGFO/xGF O/xGF-O/xGFO/xGF O/xGF-GO/xGFJO/xGF MO/xGF-VO/xGFYO/xGF O/xGF-eO/xGFO/xGF kO/xGF-O/xGFwO/xGF zO/xGF-O/xGFO/xGF O/xGF-O/xGFO/xGF &O/xGF-O/xGF)O/xGF O/xGF- O/xGFO/xGF O/xGF-O/xGFO/xGF O/xGF-O/xGFO/xGF 5O/xGF- O/ 0R b0A1Q A1/ 0R b0AQQ AQ/ 0R bAQ0A/!/!1#0@-@P40 JZtPe@ 0!"# 0!6U0@/Ơ! p6#6 r04i @D uΠ2S PE RΠ#SQZ|Q:Q:`l@*rk*\0@/@D1040 R"(!0C" R"$!0C"R""!0C"R0C"0C01C S  b 1 b0@T0@/@@T @@ d010@/ @d d00@/10@/46#!@PE 40 0@/10@/ʰ#0@/E20@8/1Q0@/0 FV10@/0/0@-K2@P0/0@-K2@Q`B| a43!/23/0@-MQl /0@-P /0@-QZpK2@!˰D    ! 0bà01@7p@-̌!J#Z 4 5u @`!:VV6 ŽP!`S<@D VL*P` T \^p@/a!@T Ptp@/@T]6tp@/@d @T @ @ Pd50!1p@/ @d Pd40p@/ Pd04511p@/4a@D 5a 0PE 0 4#Z 5 ``!p@/`` 4f  5f!p@/>p@/p@-̌!J#Z 4 5^ @D!VL 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \CUVp@/!@ Ptp@/@T1/#Z 4 5 4F 5 5Vh ``H@tP^x  10/p1QQP!1/Ɛƒ /  0@-PpC@/-/-3#/-/-/-3#/Ɛƒ// & * Z>>*S 51:3`//// *& *Z>>*SJ51:3//// 2RS"|"!R/.&/* b b<055 320:6// / ! 02BCG ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1 0BC 0RP1/BİCİ / @-PpC@/-/-3#/- /-/-3#/ 0BİCİ// R:0",S413`//ar$// *R:0",SJ413//ar$//PP /Q3/P3/M`-*Ѝ /M`-Ѝ /@-@/C-P` " x"H(#6!C/@-0 a@`SB/QP: /Q:P: /p- p//-PM`PDЍ/-QMpQ9Ѝ/-QM0SSP(Ѝ/0@-@PSMQ0PU0T00SЍ0@/-QM0aSSPЍ/0@-@P@TPSMU0TQ0P00SЍ0@/@-1/RO@/C-QMpP`S5S 7ViYp0P?SA ?S5Qn^P0P?S`+ )QSQ#S!QQs50TSqS50T Zqs50g0SJnЍC/-P`M?P00S`Ѝ/0@-@pPQM?U0T00SLЍ0@/P-L0`  R*RR#32 000/-tP Q0  0b R*RR#32!00000/-DP *PP#30!00 `/ Q - P R *RR#32!00 ` /0`- DR *RR#32!00@/PP  0b- P R *RR#32!00@ /D-DD0  $,8  0,<D/D-LP`p@  \(00@0@TPD/    0S0/i !!!!!! P/i@-o!oF5PMp@P~@ xP`WSPЍ@/C-"HpM@P`p` .@P 0 %`pᨀ 0Y 0`pЍC/?K- M`2@p-)  %  PAP<P@P@P@@TP@P@P00S@1 %|4XP@P@P@@T  %1!0 `P Y1P W1pp@  p3   0"P00Sp3~ 0"P00S- %$3YlP@P@P@@T@ EzP X1pP V1``Tg  B P _@P@ZP@@T21PN@P@IP@@T!  P =@P@8P@@TP,@P@'P@@TO P X1P V1``0S Y1 R W1pp @ @t X1 Y1X1!0p0    ЍK/K-PM pp x $ (,x 04~( 8< 8 @D0|HL@ 0PH 0P 0kP`0 @P@ 0P@@T 0R @P0~ `P`0wP00S@G 0@!1P 001 P`0]@P@ 0VP@@T!1P@x 0EPp|@Tx| 04P`V@x0 $x p30 0+P00S0  p30 0)P00S@  0P`0  @P@004P@@ T 00@0@ 3  0 0P0S 0PXpT  0P` 0 @P@ 0P@@TG( 0lP`(0 @P@ 0P@@T/0 0TP`00 @P@ 0yP@@T8 0<P`80 h@P@ 0aP@@Tq  0XP@T 0JPXp[ |`Vx|Y Rx  @P 0 0 @Dx @P 0 0HL@|0`Q@0` 0@x| 0@ 0 0 `@0H @ 0PЍK/?K-M01p P 0 @ 0jP d  0@0 SP Mu  el` P{P vP 0qP lP gP h3hC[@a  6UPO0!PX  $ P A@P@<P@@TB  2P; 0 +P4 XP50! 1  ` @P@P@@T%P1! P 0@   0@`  P @P@PX0P0@P@P@@T@ 0S=  P6 XU000!1 `0@P@P@@T0 P!1P@ _ @s`  `ЍK/K- MHL@`Pq@T Q  0CP# P HB@P 0H>P G `p05@ > 0, @0( $H P@P 0PH # `p0@  0 0 0@ 0 08PU  01PNH 0*P$ P 0#P  0P@ 0P L TRT@@ @  00 P0+PppW@ 0P`@0 @P@ 0P@@Tg H 0 0P] P 0 0PS WCP@00@0 0P`@0 @P@ 0P@@T0D!1PH SP `pL 0S 2DH =P @P6 0@l2 H 08@PH0 d`P` 0]PppWP 0 P`P0 L@P@ 0EP@@T_ [] @ 0 06PS WtAL 00@P 0P`P0 @P@ 0P@@TT0!1P@ 0 `p0@ 0 0 @ 0 `p0 0 0 @00 ЍK/?@-@1P p@/C- M 0zP0@U`p P0x`p 40e 0m  ЍC/=A0@- M0@PGP 1lphЍ0@/C- M0;pP0@JU`p P09`p 40& 0.W  ЍC/=AO-\$M PQ@0P`p Pp S`rp  WPVBV*VV#35!4000 s @ 0b43BR@%  x'x ,8HT*@K*TK2@0@b  `8#8P*0`F*S`F2 VPU*UU#35!3000 s@e6  0k8C13[%  x'x@$8HT*@H*TH2@0@b  ` 8#8P*`F*P`F20@d%{x'x@ $8HT*@I*TI2@0@be` 8#8P*0`F*S`F2 qWlW*WW#31 1000 0s0XP!#W*T0 c52@d8B<"0& ) L(@ $8HT\*@K*TK2@0@b  p48#8P*pG*P0pG2 b .Ƞ%8 8"H 8S  00TP N 0S p$ЍO/hO-,4M PQ@0P`p Pp S`rp( W PV/V*VV#35!4000 0s0 0c93@T% x'x )8HT*@*T@0@f  [VPU*UU#35!3000 0s0@e+ \ 0l8C93% dx'x (8HT*@*T@0@f R u8#8P**P0@f%>x'x_)8HT*@*T@0@f,O 8#88S*0*S00 0f32 00000W(0,@yW*WW#3!) P5 0Q@0 & 0P$! 0P48C( 04 8,P0 0$ (<LP sR V p   ЍK/- M 0 Ѝ/-M0 , 0<Ѝ/@-P,M`PU  n@PM U0 00Q0 0I0S00 800 00010@00p@/ 0*0 % $0@ W@5: 00W* R  T$0:0@-P   w  ~,Ѝ@/ -L$ \l lx L``\tttt4@L`$? "Ddx\|p P!   44 4 8oo ohoDPDdGCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 3.3.2 20031005 (Debian prerelease)Aaeabi5TE .shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_d.rel.dyn.rel.plt.init.text.fini.rodata.ARM.extab.ARM.exidx.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.comment.ARM.attributes  p 444 !ohhn.o, = F 8 OJU s[44aDDiDD tpPP@ ddhhhp|070701002EC7E3000081A400000000000000000000000147CEEA27000161D6000000080000001100000000000000000000001900000000lib/libpthread-0.9.29.soELF(p<44 (44444LLGiLLQtdRtdLL((<y;$:d<^c'/3F|1k#).{78"2' 28g,te6%+G95 Y #H*(/$_( r  .9Ko4- \!0&n!+-?0 S)Q&D5O*h4TUq"f }N6]~lPWs=7Jxb1wa>E[z%CBA,Xujm 3iM;pVv@I:LRZ` 7 P{  ulL7 |q(>0)04"28I`; \|GhP,8 h"* $xX=hlT"tL"g>"( o`"5td  4 ĄL0>DT h" {D L|xTe A00\-0HKlE9 ` 4|tg<Yx|HR|4$HA00}>"HL dt0bF"p2 a@X hW \R"0ح$l 4"h<"D L  h{-L>0H <Y t|8Xd"! H",<"E\>"my < "0?$Z8{> Rp `~B">> " 0"308L" h < dT=hT"=P@7al>" b0"`  L" h$/D ЫDX|lF.,;0 shHDXL"(>$ 0!D h"tHX* o` hh>$\ZhH((A 50{s H<"<(" `"R hP І  L"yz"DT" >".L"N (@[ԛ" $| d"T0 s 3< < ԢD64_l>|H k0 |R @yq h "0 HT" hX0\"H FE"0ad X" h0Q8JxP h"0=B4 m Qؿ r ' HTL"Ģ | $>D[dC\>+` v$s z o$K 0 0 h\ <RE<"\_l10 s4$O T"wG" C@k$ h<ZHD z 4hP Ti  "FJQ>D"< dkD5 tx'0GH=,4  a4cg h0>)`\"xX"P=0<MP9h?TZ e 0D Tm=IL"RDX" 0(W$"zM. $<T"_<"m4@?(`4 44,H\_fini__cxa_finalize__deregister_frame_info__register_frame_info_Jv_RegisterClassespthread_attr_destroypthread_attr_setdetachstatepthread_attr_getdetachstatepthread_attr_setschedpolicypthread_attr_getschedpolicypthread_attr_setinheritschedpthread_attr_getinheritschedpthread_attr_setscopepthread_attr_getscope__pthread_attr_getguardsize__pthread_attr_setstackaddr__pthread_attr_getstackaddr__pthread_attr_setstacksize__pthread_attr_getstacksizepthread_attr_initgetpagesize__aeabi_uidiv__pthread_attr_setguardsizepthread_attr_getschedparammemcpypthread_attr_setschedparamsched_get_priority_maxsched_get_priority_minpthread_testcancel__pthread_find_self__pthread_do_exit__pthread_initial_thread_bos__pthread_initial_thread__pthread_manager_thread_bos__pthread_nonstandard_stacks__pthread_manager_thread_tos__pthread_manager_threadpthread_cancel__pthread_lock__pthread_unlock__pthread_restart_new__pthread_handles__pthread_sig_cancel__pthread_perform_cleanup__rpc_thread_destroy_pthread_cleanup_pop_restorepthread_setcanceltypepthread_setcancelstate_pthread_cleanup_push_defer_pthread_cleanup_pop_pthread_cleanup_pushpthread_cond_initpthread_cond_destroypthread_condattr_initpthread_condattr_destroypthread_condattr_getpsharedpthread_condattr_setpsharedpthread_cond_broadcastpthread_cond_signalpthread_cond_wait__pthread_wait_for_restart_signalpthread_cond_timedwait__pthread_timedsuspend_new__h_errno_location__errno_location__linuxthreads_create_event__linuxthreads_death_event__linuxthreads_reap_event__pthread_destroy_specifics__libc_write__pthread_threads_events__pthread_main_thread__pthread_manager_request__pthread_last_eventpthread_exitpthread_detachpthread_join__fresetlockfiles_stdio_openlist__pthread_manager_adjust_priosched_setscheduler__pthread_manager_sighandlergetpidsigprocmask__pthread_threads_debug__pthread_sig_debugfreemunmap__pthread_handles_num__libc_waitpid__pthread_managersigfillsetsigdelset__libc_readpollgetppidmmapmemsetclone__new_sem_postgeteuidsched_getschedulersched_getparam__pagesize__pthread_exit_code__pthread_exit_requested__pthread_manager_event__linuxthreads_pthread_threads_max__pthread_once_fork_child__pthread_alt_lock__pthread_once_fork_prepare__pthread_alt_unlock__pthread_once_fork_parent__pthread_oncepthread_mutex_timedlock__pthread_alt_timedlockpthread_mutex_initpthread_mutex_destroypthread_mutex_trylockpthread_mutex_lockpthread_mutex_unlockpthread_mutexattr_initpthread_mutexattr_destroypthread_mutexattr_settype__pthread_mutexattr_setkind_nppthread_mutexattr_gettype__pthread_mutexattr_getkind_nppthread_mutexattr_getpsharedpthread_mutexattr_setpshared__old_sem_getvalue__old_sem_destroy__old_sem_init__old_sem_post__pthread_compare_and_swap__old_sem_trywait__old_sem_waittestandsetpthread_atforkmalloc__libc_fork__pthread_reset_main_threadvfork__libc_longjmp__libc_siglongjmppthread_rwlock_initpthread_rwlockattr_initpthread_rwlockattr_destroypthread_rwlockattr_getpsharedpthread_rwlockattr_setpsharedpthread_rwlockattr_getkind_nppthread_rwlockattr_setkind_nppthread_rwlock_destroypthread_rwlock_unlockpthread_rwlock_trywrlockpthread_rwlock_wrlockpthread_rwlock_tryrdlockpthread_rwlock_rdlock__new_sem_getvaluesem_unlinksem_closesem_open__new_sem_destroy__new_sem_trywait__new_sem_init__pthread_initialize_managersem_timedwait__new_sem_wait__libc_sigaction__pthread_sig_restartpthread_killpthread_selfpthread_sigmasksigaddsetsigwaitsigismembersigemptyset__sigsetjmpsigsuspendraisepthread_setspecificcallocpthread_key_createpthread_key_delete__pthread_internal_tsd_address__pthread_internal_tsd_get__pthread_internal_tsd_setpthread_getspecific__linuxthreads_pthread_keys_max__linuxthreads_pthread_key_2ndlevel_sizesched_yield__libc_sendto__libc_sendmsg__libc_send__libc_recvmsg__libc_recvfrom__libc_recv__libc_connect__libc_accept__libc_wait__libc_tcdrain__libc_system__libc_pwrite__libc_pread64__libc_pread__libc_pause__libc_open64__libc_open__libc_nanosleep__libc_msync__libc_lseek64__libc_lseek__libc_fsync__libc_fcntl__libc_close__pthread_provide_wrappers__libc_current_sigrtmin__libc_current_sigrtmax__libc_allocate_rtsigpthread_equal__pthread_setconcurrency__pthread_getconcurrencygettimeofdaypthread_getschedparamgetrlimiton_exitsetrlimit_h_errno_stdio_user_lockingpipe__linuxthreads_initial_report_events__pthread_manager_reader__pthread_initialize__pthread_initialize_minimal__libc_pthread_init__pthread_functionspthread_setschedparam__pthread_kill_other_threads_nppthread_create__pthread_threads_max__pthread_sizeof_handle__pthread_offsetof_descr__pthread_offsetof_pid__linuxthreads_pthread_sizeof_descr__linuxthreads_version__pthread_restart__pthread_suspend__pthread_timedsuspend__dl_ldso__ld-uClibc.so.0__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__libpthread.so.0LLLOOPPTX\`pOtOxO(|O,l,O/O=OAOFOIOv<vvOOOOO PDOOOOOOOP $OOOOOOdOOOO(O)O1 *d 6$uN $(6,048 < @ED$HLdhl|0bMMMM M MMMMN'N)N+ N0N3N4N7N8 N>$N?(NC,ND0NG4NL8NMp`@] *``@T::woC`F f`4 0]*$ `Ѝp pD-蠟0`  M P]:@V B<\A $ R Ѝp @]*x0 Q::wOC@D (V@ 8@0]*( @ = 0D-ؠ0P  @]: T0 ]* 0S::wC@ TUA00BA@Q  \ 080]*(  0D-ؠ0P  @]: T0 ]* 0S::wC@ TU@00B@@Q  \ 080]*( pD-̠0`  PM @]: `A<0S 0 S0 0<@AЍpd ] *T 0S::wC@ b,0]* pD-鴠0`  M P] :@V  <Ѝph @] *X0 Q::wOC@D ,@,@0]* @pD-鼠0`  PM @] : `<0S 0 S0 0<@Ѝpd ] *T 0S::wC@ ,0]* 0/P////Q/Q&/p@-@P``U P@Q`Tp0@-PM@T   k01Ѝ0bpD-0@  M P]:`0S 0S T 0` 0`; Ѝpd] *TP::wC@ c,` 0]* D-阢2`  M @] :tŸ  QQ 0 S Ѝ@"] *0 0S::wC@ *0]* 1  @ R01 1 pBPUI RR RN PP dA ` P^ P 0@\ Q P^ @pq ^ @ R U@ @U 1/ p@PU @Q~  P > a0 p e U' H@ 0PP `a,0`p p,0 ]*pP@cP@ 0 S / \ 0S Q /0Q0000 00000 0 /0//00/Q00/00/Q00/p@-@` PVUpG-P儡pQ@ `  @`V AT @T 0U  @`AT@  @`@  0]*`]:@ 0]*`AT01   P Ah```V::woC`F z` P  @pD-騢PM  @TI 2  ]:tŸ P ЍpT"]:D0]:4Ÿ 0S::wC@ <` `P @T `&@``T 0P@PT00S  CR .@T+  0S  ]:!R$ R 0U0CPP! 0]:t0] *h!R B!vʰ< Q::wCL X0D-Р@ 0S P mP0P  ]*0]:p P]:`0PQ::wC@ 8 JP00D-1  @]%:P0S R  R  R  P PP P0hP] *XPU::w_CPE 8P, 0]* P0D-441M  @]:0 0 0= P.PЍ0P] *PU::w?C0C 0 0]*t 0 00UP \ 010 001P0D-鴡M0#@  0 PQ P' R6 R2 0P l Q  ]":0 pP QUP  R 010001Ѝ0d ]:T0]*D < ^::wC@ a00/-M<&00Ѝ-M4&00Ѝ--,&00 Ѝ/- 0MSЍ0@-@MHPP00P Ѝ0 -RMQ  Ѝ&00pD-0@  M P]:` 0 S 0S T 0` 0` Ѝpd] *TP::wC@ ,` 0]* pD-霡1M  `]:|AT@T8 l1P+XAP `@ p R Ѝp ] *P::wC@ @ 0]* P_  PU  @,\ 0s    @"00 E-좟2  M `]:PU0S0C0  ЍP]S*|PU::w_CPE P70S 8R0`@@@@BpT 01W9 pR 0Pa P^ RPP, P^ @0S\ @0S? 8 0]*( PTA 0S U U  0Ssp @ @iAcn h P1 Ux Zɚ;,:0D-2M  @]:   @0SC+Ѝ0] *1^::wC@ S| 0]*l  @0S01 B^4 R= R9 0P  AT !R @P @8 ! 0Q @ R P !0 @PU @Q  긿,:/G-1   Pp]:@X R pX@]*0@T::wOC@D @X RT`V t0 X 0]*H @4TP T`ldGD-@@1`  @MPP ! T 0TTЍU p ^TQ @Tʄ  Xp D?PV `0 U H $08FdG|BpD-鈠 @ ` ;MRW RЍp T@pк@-@@P@pD-0QM @` P(T$ T) T Q 0 p Ѝp 0 p80   00  (O-0,! `\M @]:1PX R0 `X0TpW& X  0 @\ЍP] *PU::w_CPE Pl0 ]*\ PT@X , 0@TpdGE-2M   `]\:0؁_2pAPpP@PBU@$ "P Q \ h 0S 3eQ<1@ !7 PBUP(BBP 2@ R @ X@+@(@X" 00ߍpP@] *p 0S60C0w?C0C 0@]*0 0ꔷdGxBE-1  M P]:p U2*P- Ba0@ R 6P  Ѝt p] *d0 Q::wCpG p8p0]*( pXhHE-阠`p M 2/|0P0P U @0Tp< PЍ0 hhhHD-LL1  P]:0`,q,@1/ U:1q`@] *@0S::woC`F E` ]* ` !R ! p 0!,^\V lhhhHD-霠0M  @]*| ] *l: wL0@S![Ѝ<0]*, $ D-霠0M  @]*| ] *l: wL0@S!lЍ<0]*, $ 0D-0@  P]*0 ] * :wL0@SlQ0` ]*P lQ0<lQ0{lQ0\G-tt1  ]=:\p`Q @* Ѝ@-M"@Ѝ-@- M@0 0@  Ѝ@ Ѝ/-@- M@0 0@ Ѝ@ Ѝ/0@- M@P-@ Ѝ0p@-M@P` @Ѝpp@-M` @P  0>@P Ѝpp@-M@P` @Ѝp@-M@@Ѝ-@- M@0 0@ Ѝ@ Ѝ/@-M@u7@oЍ-0 /HB-0 /LBD-PP 0 Dp PSA0  0蘟HBLBP/-88 0  Q Q* /$/-0 /Ԟh-0 /ᬞhD-M P 0$0ߍ!N$ 0 k.*0/@ 2@n cTń0Bk"2 ̎B^)!P ꄞ- 0 VppD-XM`   P8 @0 0 RЍp<D-頠p [@%;R` Rz T@rPu p PМG-ء1FM  @T FߍM ᰑ:0 码 apP \LpDP@  H@TH  \NeQ`&fRA:0pp_P`p PG0  ;@ R  @ -@9 L" BT !mkamO-袟B貟  00 MR Ă@P E,PP ^ b0p A Rp@ t RB d @! \_0HB,0p@6 (R((2 P"\ @ @Pڟ 0 ] ' :"  P @ pQ ЍXhB@ P:@P1:1PU::wC@ |1  P@,0op@ +0 !@r#Tw lh(D-  0ĖhE-Ġp K`$;MBFPUЍ V Lp W80\ꐖpD- 1M  ]':P`p @0@ @0 PLDPPЍpl `P] *p `PU::w_CPE P, ]*00P괕 0D-<<1 @  P]* ]*1\::wC@ P0D 0S B R0 0]:xP@T 0d@ RA\ (0S ( 0!~X D-鬠0M  @]: $0 @SЍp ] *` 0S::wC@ +80]*( OpD-<<1M  @]:`\PP @`P@ p^ ]0 V Ѝp `] *0 Q::woC`F `l`0]*\ `P! 40(  0D-鈠 Mh@P @@D 00 \ ڈЍ0訐D-阠0  ]*0 ] *p :wC@\H  ]*80, mE-8p4! PM @]): 1`1 QP  P@p@@YP @ =p"Q 4P0004Ѝl`] *\`V::woC`F `00 ]* `D -L 0.9.29/lib/ld-uClibc.so.00=<)$ 7 ؿLL(  M(h41oo L77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777hmP !"#@H4hhTidkmGCC: (GNU) 3.3.2 20031005 (Debian prerelease)GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 3.3.2 20031005 (Debian prerelease)Aaeabi5TE .symtab.strtab.shstrtab.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.interp.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.comment.ARM.attributes ! ( ( )1 11: h4h4(C77>77Ip<p<hOؿؿU0]e00oL{LLLM0PD !p(U pDf( 1h477p<ؿ   0 L LLLMP 7 ؿ p< 7 0 0L=P@O< <==eL=LĔ0= 0===L =L  = ?=x@ @=A A=B B=C C=D D=E E=F F=|G G=`H |HI =J J=\M M=P Q=Q Q=xR R R=LT xT=V 8V 8V= W (W=Y Y=PZ( \Z=Z Z=P[2ܔFZ`[p `[=[s[ [=\\( \\=]]` ]=H_ \_=xg g=g=P= =P h=@i   Ti=$k @k=\k dk=m m=xo o=o o=pqd q=hq |q=s/>s s=xU $xbk4x@ 4x=$y(0, @y=z z$z, $z=4{ P{{D {|=D~ `~= 0=  (=L h= Ą=% 1 = =Ċ =܍ =(HRH HjL4=`4 =̒Ȕ\ =| = Ȕ= $=0 `=t8  =88 L= ԛ=| =@ \=( D=ğ =Ġ= p =PTD T=TP = Ģ=& 4 ح=> =L =| =ܮZ =rp =, 4=H P=t |= = =к`pl=L =l = (= =0 `= к= = = =X t== == 0 Lh8hGTi\y<iLr<hhh0<PhmdkD4ЫDC}<P<]<j4hP<q<h<<LM<< h +u<8@y?4J<W< 7=7 7dP{l{ ulL|q(004" 8I`\|=hQP,gh"$x=lT"L">"o`"td  + 4= ĄS Lg 0o >D h" {D L| xT  0 0 \ 0* HF lS \ `k 4| g< Yx   R 4 $ H 0# 0/ >"I [ Ln dt0} F"   @ X h \ R * "9 0J ح$b v 4" h<" L  h{ L> 0  < t|8 d" H" ,<"! \>"; I <X "a 0t ? Z 8 >  R`~B"9>U>r " 0" 0L"h=<G pduThT"=P@7l>" 0`   L" h5K$ZDqЫD|l,0shHXL"(>$0D/h"L\tyHXo` hh>$\Zh6(O(eA 0H<"<("`"hP2І <IL"Nh"DT" >"L"(@ԛ"$|8d"?0Vsiy<<ԢD4l>|H 0 |"@y'9h "V0cHT"ohy0\"H E"0d X"h40<8LxePsh"0=4m  $Q7ؿ = VHThL"n}Ģ|$>Dd\>`5v$D zJo$e0q0h\<R<"\_l0s4$1T"7G"MZCp@k$h 4hPTi"%J7QH_d>D"~<dkDtx0H=,4* @ W4cyh0>`\"xX"P0<Ph?T  10> Rj=L"DX"0(W$"M $<T"<"4@?(0`4D4O4U,Z\initfini.c$a$tcrtstuff.c__EH_FRAME_BEGIN____JCR_LIST__$dcompleted.2604__do_global_dtors_aux__do_global_dtors_aux_fini_array_entryobject.2648frame_dummy__frame_dummy_init_array_entryattr.ccancel.ccondvar.ccond_extricate_funcerrno.cevents.cjoin.cjoin_extricate_funclockfile.cmanager.cterminated_childrenmain_thread_exitingpthread_kill_all_threadspthread_start_threadpthread_start_thread_eventpthread_freepthread_reap_childrenpthread_threads_countermutex.conce_masterlockonce_finishedfork_generationpthread_once_cancelhandleroldsemaphore.cold_sem_extricate_funcpt-machine.cptfork.cpthread_insert_listpthread_atfork_lockpthread_atfork_preparepthread_atfork_parentpthread_atfork_childptlongjmp.cpthread_cleanup_uptorwlock.crwlock_can_rdlockrwlock_have_alreadysemaphore.cnew_sem_extricate_funcsignals.cpthread_null_sighandlerpthread_sighandler_rtsighandlerpthread_sighandlerspecific.cpthread_keyspthread_keys_mutexspinlock.c__pthread_acquirewait_node_freewait_node_free_list_spinlockwait_node_free_listwrapsyscall.cpthread.ccurrent_rtmincurrent_rtmaxpthread_handle_sigdebugcurrent_levelpthread_initializepthread_handle_sigrestartpthread_handle_sigcancelpthread_onexit_process__libc_multiple_threads_ptrinterp.c__FRAME_END____JCR_END____pthread_mutexattr_destroy__GI_sigaction__pthread_mutex_lock_call_via_r2_DYNAMIC_call_via_r6__pthread_mutexattr_settype__pthread_mutexattr_setpshared__pthread_mutex_init_call_via_r5__dso_handle__pthread_mutexattr_gettype__pthread_mutex_unlock__pthread_mutex_trylock__GI_nanosleep_call_via_r3_call_via_fp_call_via_r8__pthread_mutex_destroy_call_via_r7_call_via_r0__pthread_mutexattr_init_call_via_sl_call_via_sp__GI_waitpid_GLOBAL_OFFSET_TABLE__call_via_r9_call_via_r4__pthread_mutexattr_getpshared_call_via_r1__fork__GI_raise_call_via_ip_call_via_lrlongjmp__libc_tcdrain__linuxthreads_pthread_threads_max__libc_sigaction__libc_pread__old_sem_trywaitwaitpidpthread_mutex_timedlock__libc_fsyncgetrlimitpausepthread_cond_signalpthread_rwlockattr_setkind_np__pthread_exit_code__pthread_restart_newpthread_mutexattr_gettypetestandsetpthread_attr_destroyrecvconnect__linuxthreads_initial_report_eventspthread_attr_getstacksize__pthread_oncepthread_createsigemptysetpthread_getspecific__new_sem_destroypthread_rwlock_rdlock__pthread_find_selfgeteuidpthread_attr_initpthread_mutexattr_getkind_nppthread_rwlock_initpthread_rwlockattr_getkind_nppthread_exitsem_timedwait__exidx_endmunmap__pthread_manager_thread_bossched_getparampthread_condattr_setpshared__libc_fcntl_h_errno__new_sem_initpthread_rwlockattr_setpshared__pthread_manager_event__fresetlockfiles_bss_end__errno__linuxthreads_create_event__libc_accept__libc_current_sigrtmaxpthread_condattr_initgetpidgetpagesizepthread_attr_getstackaddr__pthread_suspendpthread_key_delete__old_sem_post_pthread_cleanup_pop__pthread_lockmemcpypthread_cancel__pthread_initial_thread_bospthread_mutexattr_destroy__pthread_reset_main_thread__pthread_do_exitpthread_equal__cxa_finalize__libc_nanosleep__libc_current_sigrtmin__pthread_sig_debugsem_destroysystemmallocsiglongjmppthread_attr_getscopesched_setscheduler__new_sem_post__pthread_initialize_managerpthread_rwlock_destroyrecvfromsem_waittcdrainpthread_attr_getguardsize__bss_start____libc_longjmpsem_postsched_getschedulerpthread_testcancel__pthread_manager_sighandler__libc_pthread_init__pthread_attr_getstackaddr__linuxthreads_version__linuxthreads_death_eventpthread_rwlock_unlock_pthread_cleanup_pop_restore__pthread_attr_setstacksizepthread_attr_getinheritsched__linuxthreads_pthread_keys_maxpthread_kill_other_threads_npsem_unlink__libc_pwrite__libc_read__pthread_kill_other_threads_np__pthread_initialize__exidx_startlseek__pthread_mutexattr_setkind_npsigaddset__linuxthreads_pthread_key_2ndlevel_sizemmap__pthread_alt_unlockpthread_detachsendpthread_attr_getschedpolicy__pthread_handles_initpthread_attr_setstackaddr__sigsetjmppipe__libc_lseek64__dl_ldso__accept__libc_allocate_rtsigpthread_getschedparam__libc_pread64pthread_setcancelstate__pthread_functionsnanosleep__pthread_wait_for_restart_signalh_errnocallocsetrlimit__old_sem_initpthread_condattr_destroywritepthread_attr_setscopekill__pthread_destroy_specificspthread_mutexattr_setkind_np_stdio_openlist__pthread_nonstandard_stackspthread_cond_broadcastpthread_once__deregister_frame_info__pthread_once_fork_childpthread_attr_setinheritsched__pthread_alt_lock__pthread_manager_adjust_prio__pthread_manager_thread__pthread_setconcurrencypthread_setschedparam__pthread_perform_cleanuppthread_key_create__pthread_initialize_minimal__bss_end____new_sem_waitwait__libc_open64pthread_setconcurrencysem_init__pthread_mutexattr_getkind_np__pthread_handles_numsem_closepthread_killread__pthread_manager_request__pthread_internal_tsd_getpread64__linuxthreads_pthread_sizeof_descrpthread_attr_setstacksizesendmsg_stdio_user_lockingpthread_rwlock_wrlock__pthread_internal_tsd_addresspthread_rwlockattr_getpsharedsendtosched_get_priority_max__old_sem_getvaluepthread_sigmaskon_exit__libc_siglongjmp__pthread_compare_and_swap__libc_send__pthread_attr_setstackaddrpthread_cond_initsigfillsetsched_get_priority_minpthread_rwlockattr_initfork__pthread_restartpthread_mutexattr_getpshared__libc_pausesem_trywaitsigaction__libc_close__pthread_internal_tsd_setpthread_condattr_getpshared_pthread_cleanup_push_defergettimeofday__bss_start__libc_openmemset__aeabi_uidivopen64pthread_mutexattr_settypegetppid__libc_recvfrom__pthread_threads_events__libc_systempthread_mutexattr_setpsharedpoll__end__pthread_attr_getdetachstate__pthread_last_event__libc_recvmsgpthread_mutex_unlock__pthread_manager_reader__pthread_initial_thread__h_errno_location_fini__pthread_offsetof_descr__new_sem_trywaitmsync__libc_waitpid__pthread_unlockpthread_rwlockattr_destroysem_open__rpc_thread_destroy__pthread_attr_setguardsize__pthread_exit_requested__pthread_attr_getguardsize__pthread_manager_thread_tos__old_sem_waitvfork__pthread_once_fork_parent__libc_forkpthread_rwlock_trywrlockpthread_rwlock_tryrdlocksigismember__linuxthreads_reap_eventfsync__pthread_manager__libc_lseek__old_sem_destroy__pthread_getconcurrency__pthread_alt_timedlockpread_pthread_cleanup_pushpthread_selfpthread_setcanceltype__pthread_once_fork_preparepthread_mutexattr_init__libc_wait__pagesize_edata_end__pthread_threads_maxpthread_mutex_destroypthread_mutex_lock__new_sem_getvaluesem_getvaluepthread_cond_wait__errno_location__pthread_timedsuspendexitpthread_attr_setguardsizesigdelsetpthread_mutex_trylockpthread_atfork__libc_sendmsg_errnopthread_cond_destroypthread_attr_setschedpolicy_exit__pthread_timedsuspend_new__pthread_sig_cancel__pthread_sig_restart__pthread_offsetof_pid__libc_recv__pthread_main_threadpthread_mutex_init__pthread_attr_getstacksizelseek64openclone__libc_write__libc_sendto__data_startpthread_attr_setschedparam__pthread_sizeof_handle__pthread_provide_wrappers__libc_msync_Jv_RegisterClasses__pthread_threads_debugpthread_attr_setdetachstaterecvmsgfcntlsched_yieldpthread_joinpthread_getconcurrencypthread_cond_timedwait__register_frame_infosigwaitpwriteclose__libc_connectpthread_attr_getschedparampthread_setspecificsigsuspendraisefreesigprocmask070701002EC7E40000A1FF00000000000000000000000147CEFADA0000000F000000080000001100000000000000000000000F00000000lib/libdl.so.0libdl-0.9.29.so070701002EC7E5000081A400000000000000000000000147CEEA27000166DF000000080000001100000000000000000000001300000000lib/libm-0.9.29.soELF(4(4 (444      Rtdg~[PDlfY)`:pws6 XImZahjUn9NMz;k/Q!<eT yu3rS FbCB &.(%@1'457 8RJ+\-,? ci]AdK*0L_OqE^}Wt=H"2|Vx{$o>G#v@8DLX $ .89L8l 6T (@LXl#xQHw4[$0<$lHDhdE g\D 0L`^ h$,`<>8`,(se Bbd {\T4lH^<p(a,(8Tt`d 4d5ldGX]:8l|R( VLL`\P0`(иI L`Dh!``bT40(5(88E4+LXM4<pQHW,+080<P8(zKDPT:2 d {sP$S\xX! >`_],$g@x HF@q}lDXX __aeabi_dsub__aeabi_ddiv__aeabi_dmul__aeabi_dadd__aeabi_dcmpgt__aeabi_dcmplt__aeabi_d2iz__aeabi_i2d__aeabi_dcmpge__aeabi_dcmpeq__aeabi_dcmpleasinhatancbrtceilcopysignerfcexpm1fabs__finitefloorfrexpilogb__errno_locationldexp_LIB_VERSION__aeabi_d2lzllroundlog1pnextafterscalbnsigngamsignificandacosacoshasinatan2atanhcabsdremfmodhypoty0j0y1j1ynjnlgammalgamma_rloglog10powremainderscalbsqrt__aeabi_fcmpeq__isnormalf__isnormal__finitef__isinff__isinf__isnanf__fpclassifyf__fpclassify__signbitf__signbit__isnanstrlensprintfstrtofstrtodcargllrint__aeabi_f2d__aeabi_d2facosfacoshfasinfasinhfatan2fatanfatanhfcbrtfceilfcopysignferfcferffexpm1ffabsffloorffmodffrexpfhypotfilogbfldexpflgammafllroundflog10flog1pflogfmodffnextafterfpowfremainderfscalbnfsqrtfcargfllrintf__dl_ldso__libc.so.0__fixdfsi__gtsf2__gesf2__ltsf2__lesf2__cmpsf2__nesf2__eqsf2__aeabi_cfrcmple__aeabi_cfcmpeq__aeabi_cfcmple__aeabi_fcmplt__aeabi_fcmple__aeabi_fcmpge__aeabi_fcmpgt__fixdfdi__fixunsdfdi__aeabi_d2ulz__aeabi_d2uiz__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__libm.so.0015<BGQWďXȏd̏jЏsԏx؏|܏~-yƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXC-!B! RM 1ƃQ,,Ѝ1C RQ  06 @P 0  0 `p 0 0{h%d5xX%X5~ 0p@%@5 0h(%(5n 0`%5o 0X$4^ 0P$`p4I$4X 0A=$1F 08$4G 00Š6 5 0$ 0# 0( 0 # 0 h5ƃ Rb 0 #3@P#3 0#3 0h#h3 0P#P3 08#83 0 #`p3 # 3 0͠1" 0"2 06 0 0  0 0  0P 0 0U6 E6 @P!1!1 0!1 0yl!l1 0qT!T1 0ikA>,%jV?lf?>UUUUU?B.?u<7~?ttO-q`aF‣$M [`p^p @a`QpbpĠƌ ^. 0($Ѝ[f[K:C@ [ 5S@/B0S@`VL:/C B V p5S/ BO D0S BN P4ˣ6ãF c`7Q 0a83A 0ACN R46ãf cb7Q 0a93pa 0Ac0b0CisϠ XfA2Q@@UtQ00@000T03ST Xf@2Pi@ T@T㈀ BA R/bǁQ 0a3T8!Q8! 0a# `AT&0 0 `]YA. 0 B҅An F0S B~XA0@dAA0S@]vD0`* a;]t-  dZtM K-Pp`[(M0 n@ 0\!  "C`p(Ѝ_Ġ&[afAQQ" 4 ƃ 0 p  0_H@E@"!  0PS P@ 0  $ P1  0 `p 0 0 0  0 `p^  V@ 0`pavF[L!`p "`p 6""`pz  6@ pP 1 0  0`p 0 0 0 0 0  0`ppᖵKG!fA 0Q!W?`喵E! 0F@!Ha O-鸢@P6@Q Mʔ"QzʌbQq|2|"0`` @ p(`  0/E 0& @P% , 0 % 0  0`  0p `p  0 0 0 06 0Š 6Ѝ0 0 0pp p(` @ d0d  p (`   s$V.@l@v0vPuut(uuuO-$6@Q ,M#QBQq2" p`P@ p` p(`P @$( 0 n0 e @Pd k 0] c 0U [ 0M p S 0E` K `p<$ B 04 : 0, 2 0$ * 0 " 0Š6  0 5 0,Ѝ0 Pp` p`0$ p(`(! 0 x0 `|0| 0@L(`PK p@ 0 @P $p]4S.@l@xwwvvXvvwHwK-!6B[(M`p@P 00 (Ѝ&{u1C[Z"#3#3 0 #3 0 6N 0 #|3 p#p3 0 xX#X3~ 0 p@#@3v 0 hŠ 6m1&C[a 0X5 6i 0 RŠ 6W"2SŠ 6RP [ 6: 0T,`p 0 < 0 -AD[U[G 0@Pu 0 0!1@P- 0Ju6 e6 @Pp` 0 0 @P 0  0", @P0 0"o 0P  ` 0Pq! ?s39P ѱ>(?]t>ՄT;>WҦ?Ȃ?u<7~mBP ?C-6HX4M`p@P 0 00 |4Ѝ@ QxX #3q#3$0 d 0^ 0]@P ,#(3M#3S 0E#3T 0="2C 05"2D 0-"23 0%l"l24"`p2"2! 0l"l2 0 T"T2 05 6 0 @P !1 0k +!!ADX1X"z 0@P- 0 08!81@P+ 04+ @P0 0' 0L!P@,(@ 0P"!m0_?˙?ȳ?i=ŽԫN;WU>\s>k M6?lL??;P=-d>x?ɑp?mBP ?O-鸢@P6@Q Mʔ"QzʌbQq|2|"0`` @ p(`  0FE 0= @P< C 05 < 0. 4 0&` , 0p $ `p  0  0 0  06 0Š 6Ѝ0 0 0pp p(` @ d0d  p (`   sF.@l@xy0x`xwxxxO-(6@Q ,M#QBQq2" p`P@ p` p(`P @$( 0 0 | @P{ 0t z 0l r 0d p j 0\` b `pS$ Y 0K Q 0C I 0; A 03 9 0+5 60 0Š7 ' 0,Ѝ0 Pp` p`0$ p(`(! 0 w0 _|0| 0@L(`PK p@ 0 @P $p\C.@l@Xzzyy8yhyy(zK-ADA(M T 0(ЍtuT`#`3 6P Š 6 #3@P#3 0"2 06 0`p6  0"`px2t"t2 0z\"\2 0rD"D2x 0j,",2p 0b5 6g 0V 0 ]x"o(`p 0W 0 Q6@T2TF)d!@P\10 0*[ 1Y 0!@Ph 0 0& 0@P) 0!   0 0P  !u<7~ Fj>h>a,G W?~*=,}Ɉ5>?3>d͹V_(?S~c ?mBP ?C-a6Fa,MV@P 0 00 ,Ѝ@ Qv5Vi $0  0'@PJ 0  0LV+V(`p 0@P 0y 0}"2q 0k{(x"@Pp2e 0_ f  0V 0_P~ !K J@Pi!1DHU_?,)vө?<f?*w9P=[:>NZ>dw%l*?M? e?0_?K-@bAτ\M`pP@PЍ S$P`00cX$ X 6T@P ATh\ *<JR$ 0s@P 0k@PЍK@Pq' 0Y@P[ 1@Pѳp&@P 0Y`!`1D@P]&@PQ 0E@PI&E&@P 0%:qX@P! 0 0 q X0@P@P@P  0@PLmBP ?K-@bAτXM\`pP 0`pXЍP2[ [8 &@TQ `p  1`pXЍK  P tfGTP U!-` 1`[!p XЍK6LT*![6 [[` 6$p@P 0q  0k@U`p$_`pꋐ p%V%@PP"W 0eF6 U4 `p8P0,0 A , " < 0.!> 44@P!,aP`@p,@,p 0@W 0!)%!"e 0@DQ"'P 0|#|3P KPڀA 6#0 0% 0p 0` 1I00PUCc 0 0`p[`p@% 0 0@[`p`p@P% 0`pB@`$ 0!1@P$@P- 0%pP$ 0@P$KP9ڀxЁ 6$@P4 0W%R 0d `p1] 0@PPP 0 9 03%`v4d0LS40Zu`vV 0!p 6`$eA9B.@mBP ?}Ô%IT-  (-tK-avFaHMV0@Pp0 `pHЍ 1&LVQ 0!1&0  vĎVڼ~Vk  0$ 0 |.|>@Pp.p> 0X.X> 0@.@> 0(.(> 0.> 0-`p=-= 0-= 0-= 0-= 0y-= 0s 0w4@P 6 f 0j 0f`pu 0Q`pVQD`qP`p[L 0U`pE/ I V!@AVBT4@|,|<2 0@P 0VP  E 0 i0  P00  1  0S`q$BV50@ 06 l+d;\+\; 0H+H; 04+4; 0 + ; 0 + ; 0*: 0*`p:*: 0*: 0*: 0*: 0|*|: 0Š6 0 0 @D`pT8&5DU@V 1 0q 0t`p@V1 7i 0[@P5@V6 Y 0K@P@V7 I 0;@PA7 <@P Q@\"TP 4 /@R 4 ^C4 6BP"P43$# 1'7 0PP 0@Qd'd7E"@'@7 0 07 '7 0 1Š"&6/s&GV `p 0&6@P&6 0&6 0&6 0&6 0t&t6 0\&\6U6`p Š@P6  0pV%5z 0$ 0` 0Z%5@PU%5d 0M%5S 0E%5T 0=h%h5C 0 5P%@5.<%<54 0&$%$55 0 % 5$ 0$4%$`p4 $4 0$4 0$4 0$4 0 0 0 0PP 0 8$84s#(A@ VD@e 6 0`pn5 6 0$6  #`px3 l#l3 0\#\3 0L#L3 0<#<3 0!1 0#@P 3 |#3 0v"2| 0p"2v 0j"2p 0dŠ6 i 0X 0_$]`pŠ6 K@P{ 0U 0I1 6;p-RV"2D؀?´?7X?}P?ƶ@?kحg?{T"?L?RBtp>M,?]?oS?O@~?bU>?Ȱ}gij?-DT! @E?9hs&^?a~H?徜?YO?x6?@>[A}I?u.t?'?ӓ?tbE?C ZLgK?AˀC?8ϘJ?\.lf?;UUUUU?i}ɐ?ô??Vcb?lm4?-V?Dpx?5ߨɠ?8+?8$4a L?.n? f? ƍ'?>5?sA?.ӂb?j쑺?AՔB?PBü?Ci? +g?$ N?PDvI?o\G?]@?aWZj?|SU?PP?+%@aץ@`?Za?K-Q M`p  QCd 65 `p6L^ 0 Ѝ EN 6 ,O@0@D 6,ʄ0&R 1x 0h} 0c 0`p^T$T4@PYH$H4_ 0Q0$04W 0I$4B$4H 0:#3@ 02#38 0* 0 .a:Kk*kGC@P N0S6  0\l 0 0 0  0 h 0a 0P  RW .sG#2@P"`p2 0B 0 0; @P4"426 0^< .cF#1@P!`p1 0 .sG#1 0`p 0T!@PL1 0 0  0 0Q  0} 0g 0u.cF#0] 0`pi 0Sd @Ph0M 0Qx ?xq??DR>?˖dF?Y"$I?UUUUU?B.?v:zz+eG<ː@YnG?D] T>UUUUGC.?9B.?9l a\ Фri7f>kA>,%jV?lf?>UUUUU? 0 0;T d cXX00c0@K K-M `p@P LA T 0Ѝ ^  k0l0 0 NP 0X`p@P  ^) 0 0 P  0@P 0 0 rP  0@P0,e6 k`p 0pP  0o@P 0JP O-5圥DMX `p@P0 DЍP%X Hş X&N X 0B`Vs%57`pX $4. 0($4%5$4@P 5 6;%|4 0L$D4[`p 0!ʠH*:c^-iŠ&3`p 0#3"@P 0 0`p 0!*:P@a1P 0 0Sj0k! b%2p`Xz "2 0"2HHʠAL@ Hp@P 0BAT6 u`p@P 0CADz6 e`P@`D0 P@D0F 0(Q k0! iE&h1Nl!l1@PI 0C@!@1@4  !X4  03hiU&0" 0@P 0 0.$0`p 0 |0 @P 0 0`p!?{@!9A!?1cba=m0_?!sp.;h{zI %{9@-M@P`p`P  0ЍTPP  0P 1 0P 0 0 0P h0P < CЍ@+ Ѝ@", Ѝ@@C-1Ca V M@P 0u@P ЍQN 6 (NV34 C VG"2\ 6[Pp 0 K `p 0 ;Š6@P  < 0+ 0;4HV-@V588T V0  ! 1@P 6 3QFEV5 6 0  0 } 0@P5 6n@P 0 0@Pk3t<{A.@3@3@}C-!"4*6R M 0`pP @p QyL*P BtIf?_ @0S cФP @p`P R00Q00S P` 0Q l@a BpP U @ &p5f* ЍV0TŠ\ B 60 0 c>c w00 0J 0N`p10 Q 0L 04`pC-a$M V 0@P!\]PT #3@P"2 0"2 0 "2 0"2 0"2 0e6  `p 0 @P 0 00 $Ѝ !1@P!1 0!1 0t!t1 0\!\1 0D!D10 ,1V%)V*Š '8!u`xŠ6  0 `p 0| @Pw 0 0 0{F00a 0o8ı!>RO~>>wQlV?LUUUUU?23?O-H|`BDVM<̟_rDe ^࠳ `LQL@(P$$ C0(0$ p 0JL`@bQT9!V@`P(^&0$P$@T`p ͍P`pA 1P/D 0`p^@DP X`(`H`HHP p#>GU"# 6 4 6@P 0 ; `HX`p0 a 5@P6 0P@, 0@0PP6H 0`N P `R#BR,40,0P 4P-, H0`S,```#΍ ScH`P V0 c ̎00H P0PP P  4 Rj  0P H(@N T ]  !(@P0AT BPw( m!TpW B BP\ H`pWH`CL@ P0∑P@P8<88$<Y -PA 1P/D 0 ^@D@ pW8<@@ P8}W>a*??IUUUUU?K- K8M [@P$!P  0`p 0 @P0$4$4 0p$p4 0wX$X4} 0o@$@4u 0g($(4m$$4]$4c 0U#3[ 0M#3S 0E#3K 0=#3C 05 0 9 0, 01 0# 0(@#@P83 0#[MXP d"  pP6 !`@ 0 0 0  0 0G,B[8$PU^!!@P 0 0!!X$0`pCϠ b 0 @P0 0# 0 1 0 0 8Ѝ!X0  XP !| Š 0rp` 1!"!sS`u󾦒7~?eDC?(V"mm?7d?z?ztp*>2?h&0?W?n&?A?cUUUUU?'?-DT!?\3&<!B! RK- 0C  LR-AĠ R^R0P e@P 0 "6 (M `p0  00  0 T, 0 5 6P 0 E6 `p@P  5 6 0 0  [   0u<7~9B.?O-$㬤BA T MĠVT@P 0  Ѝ 7NT7C6LT 0 `p 0#3@P#3 0#3 0#3 0x#3~ 0p#3v 0hx#x3`pad#d3p 0YL#L3h 0Q4#43` 0I#3X 0A 0\VB 0 40"A @ 0 = 07[ 1o  P  RcQ\\TXbT"T2 6PYd+ a 8FT) XxETMŠ6 P6p  0E 0  0 'p!T ڿT 0'u 75@`  76 0 05 6 @` 1 0":? v$K{?Q=Рf ?n LE?$I? UUUUU?/lj,DR-ޭ?mt?q#q?똙?||-DT!!?u<7~@K-!6BM\ 0`p@P  0m`pЍ  0\ qC$Ƃ 0P@ੀ*teG\FmE 0 A < 0 :x!x1@t!t1@P; `p0XX( 0/ 0884!41' 0 0 0 0 0`p 0 0 0  00 0@P`pL@+tfG\FmEꫪ__??42%ޑn۶m۶?m۶m?VUUUK-Aʠ 0M *:oC`FV@Pp VGpKW&00 p @!@1 0P Y6Sv pp Ѝ3V F03  0 0P p WVp 4fT p   V 0D D0y 0yP Yq puv pu<7~-!1Pp`@/0@-!M R@PLR 0W 0Ѝ0 \ \ \! 0 0 0! 1! 0! 1!?K-!BA TMڡP@ 0 0Ѝ!B T'LT}ڿ1'LTQ4 CTg 0(8@P(8 0(8 0(8 0t(t8p(`ph8\(\8 0D(D8 0,(,8 0(8 06 0!B Y 0  0 0 ~0 wE6 T'T7@PhH'H7n 0`0'07o 0X'7^ 0P'7_ 0H&6N 0@&6O&66&6< 0.&64 0&&6, 0p&p6$ 0X&X6 0 6[H 0  0 0 5@P  6 0Š 0  0 0lT`%`5X%X5 0 @%@5 0 (%(5 0 %5 0 $4 0 $4 0 $4$4 $4 0 $4 0 $4 0 l$l4 0 wT$T4} 0 o<$<4u 0 g$$$4m 0 ^6 dp e1PR"8 a!Z@ 0`pJ 0< @P4 0; 0 ,[w!%,$:7BTë?7#3 #3* 0 "2" 0  "2 0 "2 0 "2 0 "2"2 t"t2 0 \"\2 0 D"D2 0 ,",2 0 "2 0 !1Y 0 "15 6! 0hf#w?OQ*?i}?hn? aBCо"]!?k"t?6UL? yw?? 8a땗Y6*?(>=c? Q_?ø@?M?8uYc?5WT?Qk?5c`&?\c?3oJ?#f>??l@\š#WeRT@\g@f"(Ld@ 0O@&A%@`s4?5d `4?bt﮿JHG@,H([@pW!z@h(!+@q ){@!jR 5a@vp3@?8ܛN8~Y.ja@(u@C]d@Z_U 1@ޅp?Jo9b-qBp6ct}@;@j$h@Q@ "\t@Q&V>@ ?K-!BA TMڡO`EP@ 0% 0,Ѝ8LT!B Tڿ:7LTQ(C BT] 0X(X8@PL(L8 04(48 0(8 0(8(`p7'7 0'7 0'7 0'7 05 6 0 0  0 T8'7Q6 '@P  7 0 5o6 &6@P&6 0&6 0y&6 0q|&|6 0id&d6o 0aL&L6pH&H6W4&46] 0O&6U 0G&6M 0?%5E 07%5= 0/ 64[( 0 !"5*E 0u 0XeTH%H5 D%D5 0 ,%,5 0 %5 0 $4 0 $4 0 $4 0 $4$4 $4 0 $4 0 p$p4 0 X$X4 0 @$@4 0 ($(4 0 $4 0 6  1@P"8 ! 0`p 0z @Pr 0y 0 j[r!c0 r;#3\#3k 0 T"2c 0 L"2[ 0 D"2S 0 <"2K 0 4"2C"|2 +p"p21 0 #X"X2) 0 @"@2! 0 ("(2 0  "2 0 !1] 0  0!5 6hf#w?OQ*?i}?hn? aBCо"]!?k"t?6UL? yw?in?? 8a땗Y6*?(>=c? Q_?ø@?M?8uYc?5WT?Qk?5c`&?\c?3oJ?#f>? ?m@\š#WeRT@\g@f"(Ld@ 0O@&A%@`s4?5d `4?bt﮿JHG@,H([@pW!z@h(!+@q ){@!jR 5a@vp3@?8ܛN8~Y.ja@(u@C]d@Z_U 1@ޅp?Jo9b-qBp6ct}@;@j$h@Q@ "\t@Q&V>@ K-$6M\A 6\T %5x 0fP%5f뿴@V 0gp.I#5@PU 0Z%x5J@P 0 U  P 0M6 5@P 0/%5*$40 0 "$41 0 $4 0 $4! 0  6 `p 0 0 @P 0 `p00  0 0 [Z 0 0 0Ѝ#\4C\8 0 tS\6T.cF#\3CSg16C\0#03P1 $$ 0"2@V44 0YT  6 "2 0L"L2T 0y  0{ [$ 9P5 z0 t ʠ0P 6@k 0eŠ6 O5 6]z 6>P> 0P 0DŠ 6@f[6S `V>@ 08 ʠ 0@P P.sG#0$@Pk Z@ 0  0Š 6 5 6 0  1%yhC@A.@Yn+eG?B.v۪?UZ??B.??B.?9B.@u<7~90-1P@0/!6/K-Aʠ 0M *:oC`FV@Pp V>pKW&00 p H!H1 0P Y6Sv pp Ѝ3V F03  0 0P p W   V 0p p0 0P Y ptv pVp 4f Xp u<7~A-L\0`p@P0 @ Ct\ 6C 5`$p,:Ce6@`p\ 1&C\L:C@/0/\ RA@/A@ R@/5S@/A0S@/p@-`@P.P 0 *P  p@PP 0 P "00p!:pD-ʠ *?B0CS Mos@!@ 0 0! ʠ&:Ac1 V` ЍpSlP@ 0 0P!@ʠ$:C@\40l43 L<}!ʠ0@-Q:C$Lࠣ&\M@P&\7S< l3Ѝ0\ڮ1L3T \40l13|!*@-jQ:CtN``&^M@P&^7S> n32@P5 ? b!pЍ>^9`p3^PNq75P ^@P 4n30E e2<4^>Q%@P@P04pNW @g0TT^^QG~`pC-lƟ,M@ QPuaFaV6NV0viOXw6 0 0@! 1 0 0%5`P%5 0%5 0x%x5 0`%`5 0H%H5 00%05 0X`p 0 0 0 0@P6NQ 0@P,Ѝ/@ Qpu 6pA/ABX` 0E 0 0gj*VU556e6  AQ56 gŠ6 P NU[ 0wP X@P T\#\3`p: 0?@3.@PN#. 02@PĠ 6RP. 0- 0@PA:oCF 0`p!C4 6 0P A  VPk 0 6 0@PY.I#1@P 0 0!`p1 0 0 0 0 @P)L!L1E 6 0X .sG#0@P `p0 0 0 0@P"@PŠ6 0y??x ?˖dF?xq?Y"$I??UUUUU?vW s b<A Q3@PР K }0-@P 00D-!zἡZM:CN^ !ʘ!@ 0 0!Z:JD @R46ã6 b32@PIW @tPЍ>^@P3^'@a@ 0 0!Z$:@oA`FV@P  0PF4f4E e2>4V@P: 0p-M0Ѝ@-@* -M#Ѝ-MЍt-MЍ-MЍ-MiЍ-MЍ-MЍ-MЍp@-M` p@PЍpp@-`@P 0pp@-`@P 0pp@-`@P 0p-MyЍ-M>*S 51:3`//// 0BC 0RP1/BİCİ / @-PpC@/-/-3#/-/- /-3#/0@- M0@PP 1pЍ0@/C- M0P0@U`p P0`p 40 0  ЍC/=AB.?B.vM@f@9[6xd@ckNX@?TRfAC+ڃ(A= (k)A0,mٌ)==Lr?=W@鈇 `@ȝ @S@C^T@!ڠ;@mY{g@r#@Tz@ ۾Wj2>B?a @ݮ-OE@^Ye@!|d@C"aH@NT-@cMK@(jl<@O٪@ bkT;1>4>>ž?w'?o,@J)?@Kq@0@z]>@@Kp@""Ef@\|@eSj@1)j>?5z*@.ey@2}E@݂'z@leE\@O'M܅@ŗ @,@- zi@}g=C?cn6@&E[@IR-@ ~@=cM@g6@WD@@Q^o0@ݞ!)>{![?^v@)ѦHA@7,MV@>GH@4IeA@_3 u@#7P|[@1.}֋@S.|mY@DU|> vB?@dq7|(@1@tIK@Պo5@,R_@ۢm@zk]@QN @?ygE0vSмt@$jeЦ[ަ,d@b@^WArS%A\wW$AiCY?K lmfOs1ithZQT@9{1@)d @ѺmW@K6|K@.oOȏө5TQ?3p]qL_GӇl\_fkg#G@>1@|DNh@T@K z@1 )p`&D&H>Nih3Jޣ)ERn96_5dx=@ho@I@)H%@><^~c@k??CL>@?!?! @|@!@zj@|"@%@!)@:F,@zj/@\G1@|2@k4@5@ۏ7@!9@:@:F<@Z=@zj?@L~@@\GA@lB@|B@C@kD@4E@E@F@ۏG@XH@!I@DNn)W'4b<ACcQޫa:n$MBI .)>5D.&pA~_֑9S99_(;/ Zmm~6 'FOf?-_'u={9Rk_]0V{Fk 6^ae_@h'sM1Vɨs{`k@!?-Dt>F<`Qx;9@ %z8"6i5Oag?-DT!? s?-DT!?e/"+z<\3& $ > : ; I.? : ;' I@: ;I% $ > $ > : ; I.? : ;' I@: ;I4: ;I4: ;I &I /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armieee754-df.S //////1//////0/0////0/ /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armieee754-sf.S</2/301////2//1///1///////// .///5/01/R////P////P////P////P///0 /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcclibgcc2.clibgcc2.hL /-/-KLH// /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcclibgcc2.clibgcc2.h 2*2*2 6 | LXD H | ,DH(/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/libgcc2.cunsigned charDFtypeDItypelong long intcomplex doublelong long unsigned intGNU C 4.1.2/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gcccomplex floatshort int__fixdfdishort unsigned intUSItype__fixunsdfdi] } X}PQTQ,TU,<PQ<HTUHLPQLXTU] } }(PQl(0ST44XYXYAaeabi5TE.symtab.strtab.shstrtab.hash.dynsym.dynstr.rel.plt.text.rodata.interp.dynamic.got.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.ARM.attributes!  )1 5hh@:@HHH  PYp^dih rpC3 X$`0$&*p'',+  X[hH         x ,  4  %# 4& (- ( *7 * ,@ , 0HhMHSX HY h1 5bx xg 5 45q <5} @5D9 D9 <0(0(0(80h(4<\ 4< d?080H0x00000 ? D HD H H H Kp0(0(h0(0H(K` K O  0 0( 0X 000# 0' 0 8O R DS tW h+ W Z Z 8b2 Tb pb= xb qJ s yR y L{\ d{ ܉dH gX lh   H q  \  x  x  D  Ȕ P h ؙ < p ĩ  @  ԩ ̫      Tp  P   P  и <& l (/ 0< X TD X   L  V D_ `j x <t D~     , L   T  X  $     \  d (   0 #  / ? ( 0G 4 O X @a Dk Ht L~ P T X \ ` d h              ) 3 < E P  |  V ] <   h h ,h Hh dh h h h h h (h `h |h h hh h h hh $hhhh @h xh h h h h h 4h Phh lh h h h hh h Lh hh h hh h h ,h Hh dh hhh h y  < L    <8ȔW$xDL@5  h1'Tt9$C\VDfdpXy$ؙ yXԩ(, P!D,*,;TGиQZpd lxbtP(4&HXX 4 d{dHD@0( %`14:0(H@R,(]dg(vTb$8O DZX<5s hpx+AdTX^5$nDS{`$?<l h x |@8DX   $  $ * 1 8< L8A M U T\ g @m s LX l   x  H  4 $ 0< $ lH   Dh  d     ! \& 5 B 0I L`Q _ l h$r ,y < 8 ` (    d  \ 4 lH   <p  ,( $ 8+ Tt8 `A dH T 4[ d` o dt Xx }  8   | (  L    L`  P  0 ( и    % L`. : A DhI O R \ d `h x ` T 4 0(   (8 8 4 LX 4  <p H ,   0 8 0< P ! (2 5 D; @ TN R  Z i dn t     P $ \  x  X   `  , $@ )H/@4:ADlJDPXX Ue_acos.c$a$de_acosh.ce_asin.ce_atan2.ce_atanh.ce_cosh.ce_exp.chalFln2HIln2LOe_fmod.cZeroe_gamma.ce_gamma_r.ce_hypot.ce_j0.cpzeropR2pS2pR5pS5pR8pS8pR3pS3qzeroqR2qS2qR5qS5qR8qS8qR3qS3e_j1.cponepr2ps2pr5ps5pr8ps8pr3ps3qoneqr2qs2qr5qs5qr8qs8qr3qs3e_jn.ce_lgamma.ce_lgamma_r.ce_log.ce_log10.ce_pow.cbpdp_ldp_he_remainder.ce_rem_pio2.ctwo_over_pinpio2_hwe_scalb.ce_sinh.ce_sqrt.ck_cos.ck_rem_pio2.cinit_jkPIo2k_sin.ck_standard.ck_tan.cs_asinh.cs_atan.catanloatanhis_cbrt.cs_ceil.cs_copysign.cs_cos.cs_erf.cs_expm1.cs_fabs.cs_finite.cs_floor.cs_frexp.cs_ilogb.cs_ldexp.cs_lib_version.cs_lrint.ctwo52s_lround.cs_llround.cs_log1p.cs_logb.cs_matherr.cs_modf.cs_nextafter.cs_round.cs_rint.cTWO52s_scalbn.cs_signgam.cs_significand.cs_sin.cs_tan.cs_tanh.cw_acos.cw_acosh.cw_asin.cw_atan2.cw_atanh.cw_cabs.cw_cosh.cw_drem.cw_exp.cw_fmod.cw_gamma.cw_gamma_r.cw_hypot.cw_j0.cw_j1.cw_jn.cw_lgamma.cw_lgamma_r.cw_log.cw_log10.cw_pow.cw_remainder.cw_scalb.cw_sinh.cw_sqrt.cfpmacros.cnan.ccarg.cs_llrint.cfloat_wrappers.cinterp.clibgcc2.c__GI_atan__ieee754_sinh__ieee754_yn__GI_floor__GI_acosh__GI_atan2__ieee754_hypot__GI_round__GI_signgam__GI_asinh_DYNAMIC__GI_erf__ieee754_fmod__GI___fpclassify__GI_logb__ieee754_rem_pio2__ieee754_scalb__GI_fmod__GI_cos__GI_carg__kernel_cos__GI___signbitf__ieee754_log10__GI_log1p__kernel_sin__GI_nextafter__ieee754_exp__GI_expm1__GI_sinh__GI_remainder__GI_hypot__GI_llround__GI_frexp__ieee754_cosh__GI_lround__GI_cbrt__GI_log__kernel_rem_pio2__ieee754_lgamma_r__GI_atanh__ieee754_atanh__ieee754_atan2__GI_asin__GI_erfc__ieee754_asin__GI_sqrt__ieee754_pow__GI_modf__ieee754_y0__ieee754_remainder__GI_scalbn__GI_sin__GI_finite__GI_tan__GI_copysign__GI_acos__GI_lrint__GI_rint__GI___signbit__ieee754_lgamma__GI_tanh__ieee754_j1__GI_fabs__GI_pow__ieee754_jn__GI_ldexp__ieee754_gamma_r__GI___isnan__GI_log10__ieee754_log__GI_ilogb__ieee754_sqrt__ieee754_acosh_GLOBAL_OFFSET_TABLE___GI___fpclassifyf__GI_cosh__ieee754_gamma__ieee754_y1__GI_exp__kernel_tan__GI_lgamma__ieee754_j0__GI_llrint__ieee754_acos__GI_ceil__aeabi_dcmpleexpm1fmodffabslogsqrtcoshasinhlroundfldexpflogb_LIB_VERSIONroundatanhfnextafterfpowf__exidx_end__isnanlround__isnormalmodfftanhf__aeabi_d2lzceillogf_bss_end__floorj1sqrtfy0__aeabi_fcmpgtcargisinfflgamma__isinfroundfldexp__lesf2yn__fpclassifyf__bss_start__erffinitef__finiteffabsfdrem__aeabi_dcmplt__aeabi_ddivisnanf__nesf2__exidx_start__aeabi_dmulgammaacoshfllrintremainderfcosf__signbit__aeabi_d2f__dl_ldso____aeabi_d2ulzrint__aeabi_fcmpge__fixdfsistrtodisinflgammaflrintf__gtsf2__aeabi_daddlrint__aeabi_fcmplehypotf__fpclassify__finiteasinhf__isnormalflog10fmodf__aeabi_dcmpgtfmodcostanh__bss_end__significand__aeabi_dcmpge__aeabi_dsubcoshfsinatan2gamma_rpowsinh__eqsf2cbrtfatanhlog10__isnanf__aeabi_i2dcbrtlgamma_rerffscalbnfllroundf__cmpsf2__bss_startilogbf__ltsf2scalbjnnextafter__end__exp__aeabi_cfcmplefinitecabstancopysign__fixunsdfdiacosfcopysignfatansprintf__fixdfdistrtofremainder__gesf2asincargfnanf__aeabi_fcmpeqscalbnatan2f__isinfflog1pfisnan__aeabi_cfrcmplej0acoshsinf__aeabi_d2uiznansigngam__aeabi_fcmplttanfceilf__aeabi_dcmpeq_edata_endilogbllround__errno_location__aeabi_d2iz__aeabi_cfcmpeqfrexpfatanflog1p__signbitfexpfstrlenrintfllrintfsinhffloorf__aeabi_f2d__data_startasinfacoshypotexpm1fy1logbffrexperfcerfcf070701002EC7E7000081ED00000000000000000000000147CEEA2900006310000000080000001100000000000000000000001800000000lib/ld-uClibc-0.9.29.soELF( 4`4 (xOxO_X _ QtdRtd_%735+*"  ,/0-461.2$   !( %)&'# ,kp T xOH W ` 0}X #\ p $wHx l: TxO , K 0L4.` H I'( b  ` PB(10 |0l  n `  M 0 `PQHH <` l _dl_run_init_array_dl_app_init_array_dl_loaded_modules_dl_run_fini_array_dl_app_fini_array_dl_getenv_dl_unsetenv_dl_parse_dynamic_info__dl_iterate_phdr_dl_unmap_cache_dl_errno_dl_dprintf_dl_pagesize_dl_map_cache_dl_progname_dl_malloc_dl_malloc_function_dl_strdup_dl_add_elf_hash_table_dl_parse_relocation_information_dl_parse_lazy_relocation_information_dl_protect_relro_dl_fixup_dl_load_elf_shared_library_dl_internal_error_number_dl_symbol_tables_dl_linux_resolve_dl_load_shared_library_dl_library_path_dl_ldsopath_dl_error_number_dl_find_hash_dl_get_ready_to_run_dl_secure_dl_preload_dl_debug_addr_dl_elf_main_dl_linux_resolver_dl_handles__libc_stack_end_dl_debug_state__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__ld-uClibc.so.0 N`0 ,@@Aэ 10 /x -0LS  S000 p-PLM !aP @@Vp -0 Lh -0L  l4 p-LMQ 0 #a PA@@Vp -0L  lx4 -L -鐠pLM 0S x`P0PS A !p R 0/0PS4 -LP 0S S0S  S =SR -0@LQ R R0  R  0R00^=R\  0-L@\)  P0 10S@ S` 0S2 SX 0Sq0! 'V @1p p6p7 @z'*P .Q  ʠ,JT@^ 0\6*q0WqPP/@ 0 lP@p pp q1q Sp^>  >A /$V  @1p p00`0AğP` Pğt$ P a?m`4  p pO(0`P09(,$1  X1 1`$`qPp A@l 0-hq0B@ !@T ,  0 R  @ 0@@P3P ppQ Ppp! @D0S@Q``Ο p焑 h |Q(@pA P ^J0SG Q #0  0SpQ  >} Q@ A ` q d P x@`R R R: `1Q` P 4R`1 `Qd! ` d `,<`! Pp@Px P!`pWd  Q:Q Qpt  `,p/S0 00S\0`Q@> :Q Q QP T T @T:T!0 P  /R R0K 0P h!X< 0 Qq p@ Q:Q QpXz  {qaKPA P`VV  00 0SK P0SF SP@ DPR pRB/W{b 0q/SuQT*0 Sz S 0bS 0K 0LPo Mh, X , !Rp0 p0S `V) p! G 1@P 0S; 0 0 SAP \/ 1Pp W0@ \0@Uq, R R 0\0T  1 C0Q0 Bq0U@ \t1SP _K<`< 0PP@ jpPpK phPp  lpp@P ǟ Q 7R P @1!@@0@T z0p 0 R0@00 ,P X 60pP0 C@TPc 0 pX pq0P hPcP@T @T \ f @T@ P0Pq0PU0 ,&Q' @ @Q P n}p\ 0  !/  p0`0@ Q PU0 0p pWK QpWE 0@@PE,0 l!Q 03/Q Q A/Pa pW r/\R}{0bX  ,DVß,0  p pfMp@@h, < 0,p> 0]!3 t(Kp<0l1 l 0 Q, pQP` & ` `! PpQ`q  R }p0>! ` p`!p`q Q PX"p0@l!0@@pp 00- 0 0 0 R00hq, HQ  1!pp Pp 0 SJ S 0bS  `q0xL0 p pmD`hp g\ p p !`ppEltP^ttPQ AT  p 80y0bLP@<mto8LRtdmD+$n\nLnln,n|nH,mmm(40p p8#HI1p p8#蠑</p p8#Ƞ/2p p8#M^ P  rq00  0S0@mp ppP`P@pPA @`q dQ d!Ƞ0`L00p`IpL!0`@A0h!0`0|q0`0@` @ꤑ` p@ -LcM @尤 0 R1  !`VL 0X K!  K 0S! 00 R@Th@T dO@aTh@ 0(\ 3T A\ ap p p p lcoK00 R B K0A ' ! P H^m 1s3P\  P000 lXY 2Ÿ PQ !  P !81 2  Pj=`fedcba`_^]\[ZYXWV)A@D l44 PP T1 ApW ap p!0`0p p!0`0 #"PX^ P L !101X (KPX PX000PXT1 A\ ap p0`0p p!0`P0XlH0PP',0`"``p`ꔜ n0nnELF -L M࡟`,$ 0 P@ ; r T00T0 P4 0P TO57NKJIHGFEDCBA@?>=<;0/1 !2S p 0P p p,P0 \   R(Kpp pp 0`0P0 0`4P0ꠗ@no0 -LMPT@ࠟa P"4  R@ 0`P0@P @tp Cp p`P <p 5p p`0x not found %s: can't load library '%s' %s => %s (%x) ld-uClibc.so.0__environmallocInvalid ELF header R_ARM_PC24 relocation out of range Unsupported relocation type %s: can't resolve symbol '%s' R_ARM_PC24: Compile shared libraries with -fPIC! %s: Incorrect relocation type in jump relocations LD_PRELOADLD_LIBRARY_PATHLD_DEBUGLD_DEBUG_OUTPUTLD_TRACE_LOADED_OBJECTSTMPDIRX &L 5 oo BX TX\,K(  NAaeabi5TEld-uClibc-0.9.29.soG.shstrtab.hash.dynsym.dynstr.rel.dyn.text.rodata.fini_array.dynamic.got.data.bss.ARM.attributes.gnu_debuglink x LLp5! * A00K0KH8_D _M_TR`X`X]p`m!`9`|070701002EC7E8000081A400000000000000000000000147CEEA27000015CE000000080000001100000000000000000000001800000000lib/libresolv-0.9.29.soELF(44 ( 444||||||xxRtd|||   -hY gMsF49__stub1__dl_ldso__libc.so.0__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__libresolv.so.0//lib/ld-uClibc.so.0{ @ o|GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2the `libresolv' library is a stub. Do you really need it?Aaeabi5TE.symtab.strtab.shstrtab.hash.dynsym.dynstr.text.interp.dynamic.got.comment.gnu.warning.__stub1.ARM.attributesL! @@)  17?||xH M$V(@kph{,  @ |    ; *3|<R^iwresolv.c$a__evoke_link_warning___stub1interp.c_DYNAMIC_GLOBAL_OFFSET_TABLE___exidx_end_bss_end____bss_start____exidx_start__dl_ldso____bss_end____bss_start__stub1__end___edata_end__data_start070701002EC7E90000A1FF00000000000000000000000147CEFADA00000012000000080000001100000000000000000000001200000000lib/libcrypt.so.0libcrypt-0.9.29.so070701002EC7EA0000A1FF00000000000000000000000147CEFADA00000010000000080000001100000000000000000000001000000000lib/libnsl.so.0libnsl-0.9.29.so070701002EC7EB0000A1FF00000000000000000000000147CEFADA0000000E000000080000001100000000000000000000000E00000000lib/libm.so.0libm-0.9.29.so070701002EC7EC000081A400000000000000000000000147CEEA2700082DE3000000080000001100000000000000000000001800000000lib/libuClibc-0.9.29.soELF( 4x>4 ($!p 444ССС  ++4--QtdRtd++W%5<x]ja&Gm@L{'M&2` L~fi,0(/icq"po7* nwN669bQq?-_H}7Q9 !w>w:13'  ScF9n[>{=N b  @ :H+BU{n*=.YS(%G#Kdny6clSruthVO&KxZE8k6XcUfG!Np`|>\v3J.Z!:mW `1?|p"<lG"mb +B[rX<xnIRJ NTxOEU{oWA zT"7gj,,elsT'q ! W}}f+H1 Vf#Qk)s4 0ejabh@~t|tA{D[v$h`gK.S5!eF~ 9YV;@yBJy CX #54\8d^F:;*)<T^u/$A\ (:68E_ R#O/^0b?qGtKpBN%H3L9 gaOJZ FT4Q5-`iDim2eK@v>H1kfJkz}XuD&^pl;'jZ-7 ?lLa]e_C* /s)I4( 3B3cA-U )$s[2zC,=d[I+CI]]WR$.82uP-$.,h\;xo~A7/&=y*vY"PySq'2EV% vDM\hV4r|Q0wdYo^C+];jL0MER ~5)_MZ>Xa|MFI?RYg8oPUs kgz%=mr}<zw(ti DOP #r_ 1dPu <W(4)`<"@}-Uy 4#D&<SVXT* $0HoDt((0{@$\1XH,Tt!4n((0U]);% 0 D/F 0 l,#  "\b0U!F40 |1Xp0aW0"8T->< 0" /' (|3TEd30#l"OLCyt0P`(08lrd"(tH0+4QL0<$0(<k D8*4 D5(d L( D0܊5%|0"P|0O+!$4`+:< &4"i%8 0%4"] 8-,|4rȌS"RXn/ `0m& q 4 <0&0K=4vg(#\82+ @0G/(DHo(D0 <j#8ed,8;<\X_,zn'l`l  P0q@.B8L+- 8'H\%#`Yd0103+0<1 7(8X0_@Lv0rXd<e* SpP!:x|!d;80URl) > t4!$*,@'P<^4/мH`$r 0- ,Ss `5,)440)"LZXȖ, 'Dk<,@s4$"P,81_HmsA p47@0*P  0 @ol0) L* x@<7s] 01TV%4so/00) pw'\kd+:L,B0"[X&8$31<48-><4$q!9xi0"CP0)$ `0 \.$)$Wd00S(v430P{b060/#(^stnz1 ".B0"Hi$fpT"W  0OVdfp<I0m>@E=4CD=Pl ]0H08V4*pD%+L 40d0,P(y l;DPYd 880U+3@0"0LZ\<-?<T*(40R  0}&$Z @e HLoV+T4+ . 4840{< [s8=Xo) ~(P"MEWp M/HH(X=*  B@$`L TH0J  $P+vs]G<",T=<L(2m+^0 *o - X0)XX-1VT | &08"5H h3PG" 0)0?!(7X\n0$184!@?>(1<)* W0P$l0"THX0BL H($j ,@.0C8$Ȣp00#d)0L4*( B^* _+04l0+\0L?(!*`$xk&4\<"d<o B0" 08, 00<%D0G0p 08dT,c$Z%0 T4r l@K,;<tC0(VdL#0Ho O~ ,,|" ,0<p0TP@0S 40K`d6X@0LH ( P5xdgf4x*8(1g(dF"L7QDHY0" &<^(DRX0QdCx!|4d 00Fr}tl g00r1^5&4"Hxf<#}  %l^4|'`(`("WI0P$ )@X ,<<c"tQ+l0EȃT4xdx0r 85(C -)4Q8%lU/_&4 =(H @|X P /4+P(, 0uP0VXD)) iP0"L`DLj0v*4pF#bd4!6*h\}8W00Q 0ds/С %4"&\hQ '8[xS)`-?<4X!8L4hX$%<<$8$,0&$ b.A<!1hc|'4wPpe{$ 00"M 0 A? t4 ,<+ "X ,0OTP< PA<"),"  h0\0$<* 4d H3 M0x'wPV$p#od%< "X`.0 -=< -=< 0"$,<4E5 `)`DR!' ,$-hs l4z$X^0@40(8$3L0La8Rsf0U}B|\TH!t:x 4,Pq( MlX%48)(P M\0Pt"WL4P0#mz$̄$0"4$$ @40L<I 0`"ZPN-D><#mm0DKJ0|509 h,(<<`@ **$ MXE{0 0]XD"%'HR>4)W&<@X'T ,x$ <-$@<< P{4PX`d lLtX<>4L((`DV}@^ 0X+,4*(m8. q 1_ 4000 X <"u08DbV:lB< |< H"dH%P0 00?LC$XpH./@RH5~_XN<\xH(\D<lH#d$ptHP'  }!9xP l,%0(@M$08 0yd',8hDu0"'4<30%+,( M&2 @HDepXT4t0S D* t0+0g4P0t?4"п8- 9/pDxm0Qu% T0  " L )x$$&8AP0S"\Y+7P`x0S#$c@ /D'03DC01hD+d"T <0L$'$h\LX D8)0%#qtS hB0"( J'$% 00p 184AT~\+-$,06@d C4SYhpln* e <A0LzPn |(,'@W | 0W<t0H7(,#0]/HH(PT9pDJtlDM 0L$%(|'hDg(I<":18W% U !2,:$ p$$(Hp0^,pY% 0s"Rd$ Pg+:(&08~8 $ !x00P`",J<w(PR l@,_p>40"0EXL,<4|<0* @(P@4$`|$7 01_%tL50b @&t(p8 l-! PA<t yp,/xIH(,8 40x@H@HG dK$"0 d0h&|HP Pd0U$hXo,H* @""LTdO+xJ)dG4? 1Р$(,hF05 (S0"LLb4* 4#*4" t" ,0tP}/I, Z Kx%$4+/Is4w2L p>0B$B T4Xk*4T(0^g@4x"y)4d1 p@" 0h4dTd/(,( hE D.dw X<,n0xt !HL # dP0(|X\L'<C*46V0"=)p<4 R0R0LDu4Z !Bt,hZX'GD<f+44cLH_pT.8B0"X"U.A4y.A<7s%@qVT~ 6\t#kH@C#$} Q0r&00 <[,0`"tDLl\|YcЈLOt@l.0(d${X<`OHR0x0KJ X lV' }< NTT0%Zdص0n 0.018401_,@$D$F$H.`@</W0#X܂u!K/0IH)|.0^4,.@<G(@g)8h,#toD&P,7$y0*!46L-4?<$< %%9#(bUb0h@K$" 0\@' F?l=4|u4$ā$), P 00&< X'4`#i X.s?.A< dC0|0lX CܽH>ȃT!Ix$d Pj:&0@ p4! | $S)D0)  >\B @0@Z e-><dQ7,=<,"D_ ;"O , )&\(DB85wlo 0&4T\ +\E .@<)0m`)L`"4=@d"x 0d!89LP !4T l8 1TV6L 00U <) XB40%cTO! (G1PXHdgHI&<$H4np) q\m%$s*TP@R/xXz0++TT10,<<rh0L(t\0`0|Xl'P 80@ L0#Ta5VE( x* +:$70LE(l 0/,;<&&h4"4`r  /X 4Yl"V0,0ff4`0Z0L(4(W"L\hL-p?< pH"ز8$$d|<'<}(8D)8'pL $0f>4s,\H'(DpP<"0"aD0%4,d<< t>X *d#)@  H?(TX$ , p- 4"LlX&O :p0 , L/x\4`%X4(o  tld@__errno_locationoutboutwoutlinbinwinlsysctl__ctype_bstderriopermioplmmap__libc_posix_fadvise__libc_posix_fadvise64__libc_sigaction__default_rt_sa_restorer__default_sa_restorer__aeabi_assert__aeabi_atexit__aeabi_errno_addr__aeabi_localeconv__aeabi_memclr__aeabi_memclr4__aeabi_memclr8__aeabi_memcpy__aeabi_memcpy4__aeabi_memcpy8__aeabi_memmove__aeabi_memmove4__aeabi_memmove8__aeabi_memset__aeabi_memset4__aeabi_memset8__gnu_Unwind_Find_exidxdl_iterate_phdr__aeabi_MB_CUR_MAX__longjmpvforkclone__sigsetjmp_setjmpmmap64syscallsigwaitinfosigtimedwait__libc_fcntl__libc_fcntl64accessacctadjtimexntp_adjtimebdflushcapgetcapsetchrootclock_getresclock_gettimeclock_settime__libc_close__cmsg_nxthdr__libc_creat64create_moduledelete_moduledup2epoll_waitepoll_ctlepoll_createexecvefchdirfchmodfchownfdatasyncflock__libc_forkfstatfstat64fstatfs__libc_fsyncftruncateftruncate64get_kernel_symsmallocreallocgetcwdget_current_dir_namegetdomainnamegetdtablesizegetegidgeteuidgetgidgetgroupsgethostnamegetitimer__getpagesize__pagesizegetpgid__libc_getpidgetppidgetprioritygetresgidgetresuidgetrlimitgetrlimit64getrusagegettimeofdaygetuidinit_moduleinotify_rm_watchinotify_add_watchinotify_initioctlkillklogctllchown__libc_lseek64__libc_longjmp__libc_siglongjmp__libc_lseeklstatlstat64madvisemincoremkdirmkfifomknodmlockmlockallmprotectmremap__libc_msyncmunlockmunlockallmunmap__libc_nanosleepnice__cyg_profile_func_enter__cyg_profile_func_exitntp_gettime__libc_creat__libc_open__libc_open64__libc_pausepersonalitypipepivot_root__libc_pollprctl__libc_pwrite64__libc_pread64__libc_pwrite__libc_pread__libc_pselectptracequery_modulequotactl__libc_readreadaheadreadlink__libc_readvrebootrenamermdirsbrksched_get_priority_maxsched_get_priority_minsched_getaffinitysched_getparamsched_getschedulersched_rr_get_intervalsched_setaffinitysched_setparamsched_setschedulersched_yield__libc_selectsendfilesendfile64setdomainnamesetegidseteuidsetfsgidsetfsuidsetgidsetgroupssethostnamesetitimersetpgidsetprioritysetregidsetresgidsetresuidsetreuidsetrlimitsetrlimit64setsidsettimeofdaysetuidsigaltstacksigpendingsigprocmasksigqueue__libc_sigsuspendstimeswapoffswaponsymlinksysinfoulimitumaskumountumount2unameunlinkuselibustatutimeutimesvhangup__libc_waitwait3wait4waitid__libc_waitpid__libc_write__libc_writevfremovexattrlremovexattrflistxattrllistxattrfgetxattrlgetxattrfsetxattrlsetxattr__assertisalnumisalphaisasciiiscntrlisdigitisgraphislowerisprintispunctisspaceisupperisxdigittoasciiisblank__C_ctype_b_data__C_ctype_b__C_ctype_tolower_data__C_ctype_tolower__ctype_tolower__C_ctype_toupper_data__C_ctype_toupper__ctype_toupperisctypealphasort__pthread_mutex_unlock_pthread_cleanup_push_defer_pthread_cleanup_pop_restoreclosedirdirfdcallocopendirreaddirrewinddirscandirseekdirtelldirreaddir_rreaddir64alphasort64scandir64readdir64_rerror_one_per_lineerror_message_counterror_at_linevwarnvwarnxverrverrxlockflockf64fnmatchnftwnftw64globglobfreeglob64globfree64_obstack_beginobstack_alloc_failed_handler_obstack_begin_1_obstack_newchunk_obstack_allocated_p_obstack_memory_usedobstack_exit_failure_obstack_free_obstack_h_errno__h_errno_locationsetlocalenl_langinfohasmntoptaddmntentgetmntentgetmntent_rsetmntentendmntentre_syntax_optionsre_execre_compre_compile_patternre_set_syntaxre_compile_fastmapregcompregerrorregfreeregexecre_matchre_searchre_match_2re_search_2re_set_registershdestroyhcreatehsearchtsearchtfindtdeletetwalktdestroylfindlsearchinsqueremque__aeabi_uidivmodhcreate_rhdestroy_rhsearch_rfstatvfsfstatfs64fstatvfs64setlogmaskopenlogvsyslogcloselogftoksemgetsemctlsemopshmatshmctlshmdtshmgetmsgctlmsggetmsgrcvmsgsndasctimeasctime_rclockgmtimegmtime_rlocaltime_time_tzlocklocaltime_rmktimetimelocal__aeabi_idiv__aeabi_idivmodstrftimestrptimetznamedaylighttimezonetzsetdysizetimegm__aeabi_i2d__aeabi_dsubdifftimewcsftimegetttynamsetttyentgetttyentendttyentutmpnameendutentpututlinegetutentgetutlinesetutentgetutidupdwtmpwctobmbsinitmbrlenmbrtowcwcrtombmbsrtowcswcsrtombsmbsnrtowcswcsnrtombswcwidthwcswidthiswalnumiswalphaiswcntrliswdigitiswgraphiswloweriswprintiswpunctiswspaceiswupperiswxdigitiswblanktowctransiswctypetowlowertowupper__environwordexpwordfreefgetgrentfgetgrent_rfgetpwentfgetpwent_rfgetspentfgetspent_rendgrentsetgrentgetgrgidgetgrgid_rgetgrnamgetgrnam_rgetpwendpwentsetpwentgetpwnamgetpwnam_rgetpwuidgetpwuid_rendspentsetspentgetspnamgetspnam_rinitgroupsulckpwdfputgrentputpwentputspentsgetspentsgetspent_r_stdio_openlist_dec_use_stdio_openlist_del_lock_stdio_openlist_use_count_stdio_openlist_del_countfclosefcloseall_stdio_openlist_add_lock_stdio_openlistfdopenfgetposfopenfreopenfseekfseekofsetposftellftellogetdelimgetlinegetwputwremoverewindsetbufsetbuffersetlinebufsetvbufungetcvprintfvsprintfvasprintfvdprintfvsnprintftmpfiletmpfile64tmpnamtmpnam_rpclosepopentempnamctermidfgetpos64fopen64freopen64fseeko64fsetpos64ftello64_stdio_user_locking__stdin__stdout__aeabi_uidiv__aeabi_dcmpeq__aeabi_ddiv__aeabi_dcmplt__aeabi_dmul__aeabi_dcmpgt__aeabi_dcmple__aeabi_dcmpge__aeabi_d2uiz__aeabi_dadd__fbufsize__flbf__fpending__fpurge__freadable__freading__fsetlocking__fwritable__fwriting_flushlbffopencookiefmemopenopen_memstreamflockfileftrylockfilefunlockfilevfprintfregister_printf_functionparse_printf_formatvfscanf__aeabi_d2fvscanfvsscanfvswprintfvwprintffwideungetwcvfwprintfvwscanfvswscanfvfwscanfclearerrfeofferrorfflushfgetcfgetsfilenofputcfputsfreadfwritegetcharputcharfgetwcgetwcharfgetwsfputwcputwcharfputwsclearerr_unlockedfeof_unlockedferror_unlockedfflush_unlocked__fgetc_unlockedfgets_unlockedfileno_unlocked__fputc_unlockedfputs_unlockedfread_unlockedfwrite_unlockedgetchar_unlockedputchar_unlockedfgetwc_unlockedgetwchar_unlockedfgetws_unlockedfputwc_unlockedputwchar_unlockedfputws_unlockedbcopybzerobcmpstrcmpstrcollstrlenstrncmpmemmemmemrchrrawmemchrstrcatstrchrstrchrnulstrcpystrcspnstrncatstrncpystrnlenstrrchrrindexstrsepstrspnstrstrstrtok_r__glibc_strerror_r__xpg_basename__xpg_strerror_rdirnameffsmemccpypsignalstpcpystpncpystrcasecmpstrcasestrstrdupstrlcatstrlcpystrxfrmstrncasecmpstrndupstrpbrkstrsignalstrtokwcpcpywcpncpywcscasecmpwcscatwcschrwcschrnulwcscmpwcscollwcscpywcscspnwcsdupwcsxfrmwcslenwcsncasecmpwcsncatwcsncmpwcsncpywcsnlenwcspbrkwcsrchrwcsspnwcsstrwcswcswcstokwmemcmpwmemcpywmemmovewmempcpywmemsetcfmakerawcfsetspeedisattycfgetospeedcfgetispeedcfsetospeedcfsetispeed__libc_tcdraintcflowtcflushtcgetattrtcgetpgrptcgetsidtcsendbreaktcsetattrtcsetpgrpttynamettyname_r_null_authauthnone_createauthunix_createauthunix_create_defaultxdr_authunix_parmsbindresvportclnt_createclnt_perrnoclnt_pcreateerrorclnt_sperrnoclnt_sperrorclnt_perrorclnt_spcreateerrorclntraw_createcallrpcclnttcp_createclntudp_bufcreateclntudp_createclntunix_createget_myaddressendrpcentsetrpcentgetrpcentgetrpcbynumbergetrpcbynamegetrpcportpmap_getmapspmap_getportpmap_setpmap_unsetxdr_pmapxdr_pmaplistclnt_broadcastpmap_rmtcallxdr_rmtcall_argsxdr_rmtcallres__ivaliduser__check_rhosts_fileiruserokrcmdrresvportrexecrexecoptionsrexec_afxdr_callmsgrpc_createerr_rpc_dtablesizexdr_des_blockxdr_opaque_authxdr_accepted_replyxdr_rejected_replyxdr_replymsgxdr_callhdr_seterr_replyrtimeruserpasssvcerr_noprocsvcerr_systemerrsvcerr_weakauthxprt_registerxprt_unregistersvc_registersvc_unregistersvc_sendreplysvcerr_decodesvcerr_authsvcerr_noprogsvcerr_progverssvc_getreq_commonsvc_getreqsetsvc_getreqsvc_getreq_poll_authenticatesvcraw_createsvc_exitsvc_runregisterrpcsvcfd_createsvctcp_createsvcudp_enablecachesvcudp_bufcreatesvcudp_createsvcunixfd_createsvcunix_createxdr_freexdr_longlong_txdr_u_longlong_txdr_charxdr_u_charxdr_wrapstringxdr_netobjxdr_voidxdr_longxdr_shortxdr_intxdr_u_longxdr_u_intxdr_hyperxdr_u_hyperxdr_u_shortxdr_boolxdr_enumxdr_opaquexdr_bytesxdr_unionxdr_stringxdr_vectorxdr_arrayxdr_floatxdr_doublexdr_int64_txdr_uint64_txdr_int32_txdr_uint32_txdr_int16_txdr_uint16_txdr_int8_txdr_uint8_txdrmem_createxdrrec_createxdrrec_skiprecordxdrrec_eofxdrrec_endofrecordxdr_pointerxdr_referencexdrstdio_creategetserventgetservbynamesetserventendserventgetservent_rgetservbyname_rgetservbyport_rgetservbyportgetprotoentgetprotobynumbergetprotobynamesetprotoentendprotoentgetprotoent_rgetprotobyname_rgetprotobynumber_rgethostidgethostbyname_rsethostidsetnetentendnetentgetnetentgetnetbynamegetnetbyaddrinet_networkinet_ntopinet_ptonhstrerrorherrorif_indextonameif_nametoindexif_freenameindexif_nameindexgai_strerrorfreeaddrinfogetaddrinfoin6addr_anyin6addr_loopbackether_atonether_ntoaether_aton_rether_ntoa_rntohlntohshtonlhtonsinet_atoninet_makeaddrinet_ntoa_rinet_ntoainet_addrinet_lnaofinet_netof__resolv_lockgethostbyname_res__res_init__res_search__res_query__res_querydomaingethostbyaddrgethostbyname2getnameinfosethostentgethostentendhostentgethostent_rgethostbyname2_rgethostbyaddr_r__dn_expand__ns_name_uncompress__ns_name_ntop__ns_name_unpack__form_query__libc_acceptbind__libc_connectgetpeernamegetsocknamegetsockoptlisten__libc_recv__libc_recvfrom__libc_recvmsg__libc_send__libc_sendmsg__libc_sendtosetsockoptshutdownsocketsocketpair__libc_current_sigrtmin__libc_current_sigrtmax__libc_allocate_rtsigkillpgraise__sigaddsetsigandsetsigblock__sigdelsetsigemptysetsigfillsetsiggetmasksigholdsigignoresiginterruptsigisemptyset__sigismemberbsd_signalsigorset__sigpausesigrelsesigsetsigsetmask__sysv_signalsigwait__malloc_lock__malloc_statemalloc_trimmalloptmalloc_statsmallinfoabortgetenvmkdtempmktemprealpathmkstempsetstateinitstatesrandomsrandsrandom_rinitstate_rsetstate_rclearenvputenvunsetenv__libc_system__aeabi_ldivmodlldivimaxdivgetptptsnameptsname_rgrantptunlockptjrand48jrand48_rlrand48lrand48_rmrand48mrand48_rnrand48nrand48_rrand_rsrand48srand48_rseed48seed48_rvallocposix_memaligna64ll64amkstemp64drand48drand48_rerand48erand48_rgcvtatolatoistrtolstrtoulqsortbsearchllabsimaxabsatollstrtollstrtoimaxstrtoqstrtoullstrtoumaxstrtouqatofmblenmbtowcwctombmbstowcswcstombs_stdlib_mb_cur_maxwcstolwcstoulwcstollwcstoimaxwcstoqwcstoullwcstoumaxwcstouqstrtod__aeabi_f2dstrtofstrtoldwcstodwcstofwcstold__cxa_atexit__cxa_finalize__atexit_lockon_exitold_atexit__dso_handleconfstrdaemonexeclexecleexeclpexecvexecvpfpathconfcuseridgetlogin_rgetloginoptindopterroptoptoptarggetopt_long_onlygetopt_longgetoptgetpassgetsuboptswabsysconfualarmsetusershellgetusershellendusershellusleeppthread_attr_destroypthread_attr_initpthread_attr_getdetachstatepthread_attr_setdetachstatepthread_attr_getinheritschedpthread_attr_setinheritschedpthread_attr_getschedparampthread_attr_setschedparampthread_attr_getschedpolicypthread_attr_setschedpolicypthread_attr_getscopepthread_attr_setscopepthread_condattr_destroypthread_condattr_initpthread_cond_broadcastpthread_cond_destroypthread_cond_initpthread_cond_signalpthread_cond_waitpthread_cond_timedwaitpthread_equalpthread_getschedparampthread_setschedparampthread_mutex_destroypthread_mutex_initpthread_mutex_lockpthread_mutex_trylockpthread_selfpthread_setcancelstatepthread_setcanceltype_pthread_cleanup_push_pthread_cleanup_pop__pthread_exit__libc_pthread_init_dl_app_fini_array__pthread_initialize_minimal__uClibc_main_dl_app_init_array__progname__uClibc_init__uClibc_fini__libc_tsd_RPC_VARS_data__pthread_once__rpc_thread_destroy__rpc_thread_svc_fdset__rpc_thread_createerr__rpc_thread_svc_pollfd__rpc_thread_svc_max_pollfd__dl_ldso__ld-uClibc.so.0__udivsi3__div0__divsi3__aeabi_drsub__subdf3__adddf3__floatunsidf__aeabi_ui2d__floatsidf__extendsfdf2__floatundidf__aeabi_ul2d__floatdidf__aeabi_l2d__muldf3__divdf3__gtdf2__gedf2__ltdf2__ledf2__cmpdf2__nedf2__eqdf2__aeabi_cdrcmple__aeabi_cdcmpeq__aeabi_cdcmple__fixunsdfsi__truncdfsf2__gnu_ldivmod_helper__gnu_uldivmod_helper__udivdi3__divdi3__clz_tab__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__+++++++++++++++++++++++,,, ,,,,, ,$,(,,,0,4,8,<,@,D,H,L,P,T,X,\,`,d,h,l,p,t,x,|,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,---- -(-0-8-@-H-P-X-`-h-l-p-|-----D/P//00 0$0(0,040\0x0|00000000000111 11111 1$1\1`1d1h1l1p1t1x1|1111111112 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2222222222222333440/44/C8/JlЍ␀0g0@-cp pp0g0- M0P   G  Ѝ0 0@-sp pp0g0@-Wp pp0g0@-Sp pp0g0@-$p ppy0g0@-(M40$ p pp(Ѝ `0g0@-tp ppT0g0@-M@ P00T0Ѝ@-+p pp:0g0@-\p pp.0g0@-@P p p@0d0--M0 0P P P ЍЍ/ R0#410%0%0505]xP0 @- p8# p@d-QM0 00 00 Ѝ@-Cp pps0g0@-op ppg0g0 00 @-rp ppP0g0@-F ppD0g00@-p pp60g0@-p pp*0g0@-p pp0g0@-p pp0g0@-p pp0g0@-p pp0g0@-p pp0g0@-p pp0g0@-p pp0g0@-p pp0g0@-p pp0g0@-M@p p@Ѝ␀0d0@-M@p p@Ѝ␀0d0@-M@p p@Ѝ␀0d00@-P@h Mn&&   00##8080H H PPXXLLT0T0\ \ Ѝ00@-@PX MB  00 0",0040 8 (@0H$<,0D04 L Ѝ0pp PM`Q@LSH 0  000`z_L:t#55-, P 0  /9-, P 0 /p90/-, P 0  / 90@ P/-, P 0 /8-, P 0 /8-, P 0 @/L8-, P 0  / 8-, P 0  /7-, P 0 /7-, P 0 /L7/-$0 S * /7-$0 S * /6-, P 0  /6D-, P 0  T6 5D-P@圠M`t p  ||@p` @   Ѝ 0 05(X @-@t  00pD-\M @P`# 4P" fP0hP" P@PPP00` S0<305|P  X \ЍpP@=`@6` 5pD-РP@M   0 `  R@   00^ P0Ѝp qP  @4(X pD-xx M P@d  P  0 `Ѝp3(X K-M0TpP@6 : 00 `0PP X 8/P 00P! @P  rPP`@T0 S 0  [ ЍV 0(  0P V PA`FV @D-|@PtM l`   P  V  0 pЍ1(X /E-(@P M p  0 `@ @ 00^   R P  hhP PЍP , TPqP\0(X pD-ԠP@M   0 `  R@ 00 P Ѝp QP  @/(X 9K-M08pP@6  00 `0PP X 8/P 00P! AP  PP`@T0 S 0  ? ЍV 0(  0P V PA`FV @E-$@PM p  0 `@ @ 00   R P !t`P PЍP$ TP,(X G-`P\1 @ MQ 8qU- ,a@P$ `T- a 00wP, (如X 0 HP  0R 0304 5*YЍt`T DPX` z@̞D v ST+t>? -pD-ࠟ@ MP`坒$ P X T00HP   R 0304 5*V ЍpDЍ/ 2@儞(0 v)t?O-TM 0R `p,@@0HPL U  vW  `F vU@p TЍ``0P L0 @  `( ?t# (X @- M0 0-- M00 ЍЍ/ @- M0 0-- M00 ЍЍ/@-MPp@  30 `!0T = Ѝ    P Q @^T  0 0A-P@?U Mp` K0 0 Ѝ  0 A V    00   |P P @T  pD-M`@ R [R *R?R +R @R !R@ )R`Ѝp0@(S@|P0S  !R \]R R  ]R@ ^R !Px$ ? -L,M,`K8` 8XP@ P, < D0 8 @႘@ ,5`L0 H pP R [Ro *R?RL +RJ @RH !R@E )RK |R' `U<0! CR񏐾vU<?LP gH00ÃM cPP gĘ8`pP`8P @(PP` )RPU*<?PNUH  g00ÃM cPP g⢘008 `0PLP  !R L Q 0]S SS 0]S` ^RkL P00000Sl 00 DXP @U 0D P; X 0T/S0( @U ND P* D@P:0U  0xPX T/\ R(K Q00D 0]PD 0SP @ 00 0 ✘T D 0BP 000SDXPp 0@T@T W  0%PD PR*X0 U/Q0 W D P D PR* P00D# ?O-@,IMT  H!PpY : J @!D;PLnJIHGFEDCd@?>E<;:9876543210/.@O+*)('&%$#"! *H @T Y 9 I @[ Y6  0/ hɟ 0S~0@pT  P8I\g [p .PXQh/Pm !\f XaY (0q`H0.\\00S PH Y p8 P \-PP V -P  ]\/ \\00S[\ \( Y 7@P ǟ-PP  PR ]R \RPP VP!m*]\PQIߍH [ 0.S  X R@?T``?T*T(P V W p/\H!@?T``?T*T T Ha `g/ +H1P [T  3 P(/TM RH!  \TY Y `V`EPƟ 0 5 P0\ gQ Y\0 PPH0 S[ 0/S~.0CH 3[w 0/Sq .S  X R lH!  (QH 0Ap ]Qs PPen00SN P]P PG \PPPUP[P0:S_ =Sx .S0S4 .S]\P ]R:P @PD@RP P 00 B:Sa C0]Sb 3PH1 ^\``H!!\H@ b g/JP\ 삟`Ha  "0 :S aCP ҕP S ̎:RaB0 ]PxPs R  =Q0]SPe$2 B @ ]CNVPP RUVPoPcL+T@T !T(QRH! 0HS`Eg@ PU ~ 0 P@tP oR [k/\  0/S R]H@p[ H1S /RPH 0OPF(\H 0Ap 9(\<H 0Ap-2 ?p@-`MP@W 0PЍp0-0 S0!0A2S 0U  Q0  0c0/TP00cO-P `lM.R @p`M Q 0 ௔`` P  P `: S S ( R lЍ P ` \\ ,0 SP!   0$0P#"0S .S0S " ̐ 0P X `@P0P  a@P   P0 Q  OP  sO-M 1( S  I  P, `pA t@PX  R 2"P p   0P`P P0A !0S @XPQ %P \ Ѝ 0 -P  ppP0UPp d@ PP?P/^/00 `h`\j P@  0 P `VZ P@P Ar0  C0 1X``,i0 XL0 C fQ 0 X  Xx P P  R} P}P೔P@oP Ar0  C0 1g`pXP`VTpWP 㻓@ 0e ^PP pX``kP@yP, 0  L0H0  0$PP@^@   0$0  $P01 6P2P@@@p` VP04?,? -LM@УPP `0`0(KSࠡ࠳! a0 \ `0 d  Q3T PX ` -X@ P@R*pP/W 00X L0 P@R*P/^UPbPP @` H 0 bP0D0 4P p0HP0``PT K OOT; UT `P FQ`WG @@Ÿ4@ ?X@P0D0 4P p QpPd P RRc X`@VPFXX0P`@LV#X 0: S2 D` S P0KX@`mP꼐K uOdPaPQ `ZP P* RD@ X P0K@`U KK P +K hP4K >P|  dK`.Pw+`P V` 8?T?,?- M0 0 Ѝ@-@M0 @Ѝp@-`@ Q S 0^ 0U  Q0 0cpRPTP00cO-P `|M.R @p`M Q 0 v`` P  dP `: S S ( R |Ѝ P ` \\ ,0 SP!   0$ P""0S .S0S " ̐0Ph  ІU=P0P І (=P   P0 Q  P  sTO-M 1( S  I  P, `pA ;@PY  R 2 P p  0P`PP0A!0S @YPQ P \ Ѝ 0 P  ppP0UPp d@ P PP/^/00 `i`\j MP@ ̏0 P `VZ P@P Ar0  C0 1Y``,i0 YL0 C fQ 0 Y  Yy P ~P  R} P}poP೔_P@6P Ar0  C0 1g`pYP`VTpWP ゐ@ 0e ^PP pY``2P@@P, 0  L0I0  0$P@%@   0$0  $P01 PP@@p` PL4?,? -LM@УPP `0`0(KSࠡ࠳! a0 \ `0 d 嫎َ Q3T NPX ` X@ P@R*pP/W 00X L0 P@R*P/^UPbPP @` H 0 bP0D0 4P p0HP0``PT ̐K ,OT; UT }`P FQ`WG @@Ÿ4@ ;Xy@P0D0 4P p pPd P RRc X`@VPFX~X0P`@LV#X 0: S2 D S P0KX@`4P̐K RO+P(PQ `!P P* RD@ X P0K@`U KK P tP,K &K  4K:P|  dK`Pw`P `p??T,?- M0 0 Ѝ@-@M0 @Ѝ0S [S *S ?S 0S/\S ]SR / Q /0@-0M@S P@ PAP000Ѝ0@-P @T坍E-pM` @pPP@ 0PG(WPЍ覎,? -8LM " 2  px@ `Ap"/@`002 后PQ gp/W/X pv3h" 0/S S E`-V@ \?K0 K2 "  "U@P%0Q R 0U P n@:"P X 00S Ơ:  S S Р"/@P `@ 2!,#2ab!9 ,# 0l@TXQ`a@>P R#20b0 0 ^ )PЍ P(-PP R#:ʠ^ -P00L e`Ps{P L?@?C!B!?E-4`S M p@ 0S# TP`% ἈP Q/^A0Q/S BRP$0`e  ЍᝈPPPTh@PᇈP Po j L?@?- /- / D-`P0 Q R 8CR0S JP T@\@-TTT 0 $0S (05 S/<$d@D-`` @P 0 a 0S@: l@-PM `Ѝa ӊpD-lM`  @=<;:987654/5 R (Q 0%"P Q  Ѝ6   _P  @_0 !;  S (0 \$00ťK`VY0 p``pP\C( AL<P^ @0'0FVS񏐷~|zyxwvutsrqponmlkihgedc\w|_T { [(000S (0 ( @ LQ( d 0 0B 00=X  007R 2; R  * E%+ \ 8  P00<  S00 <  S00  00   00 0 0  !  00   QzA @0 0  < 0  "00  00   P00  1 F0 0 0 0   0 0  ˠ  P00 < 0  #00 !00  @0_V# Q  pw  0R `q LP `0 p0p0괯0@-MP(@@(@Ѝ0@-pM@`P 0S ,PS S00/P0S 9PuQ u 0"0P@0PB U 0PSPЍ0@-QMP00Q- PP@ @At RZ<Ѝ0NQ T  D1 3   \M\q:P_T 0@-0@MPS   R Ѝ0 Q6 Q, @4?\"131 @4?\ X $ ? Ƞ,    1T   T0@@-pMX @eP`U&T0 @p U 1 "$?;(Q"(R  W  W     ЍO-$00 JS0 0 PK R+ t%  itKV:K-M \pT$P\ aP0 R RP03 |@X @| 1S  ЍP@ |@`| 1|K-M\ P%  1 \p DP @ pW`@W Q@ Y40[(uP Ѝ83@P` pPw4 (pP4\H` ! T?7^P  "?[8 s 3#XP00S*4 P.20 "4 3 P5 PPU ( W2      @  lP P P`\ PP A P4440@ 4 P( z40  4 K-M\ P  1 \DP @ pW`@W Q@ YP Ѝ8@PJ P9PM(P^7`P04 Q#220 "4 $ Q6 Q 0$?\ 4 4^1Q4?'Q 40"!"  044^4 ^PP  0P040@ 4 K-(M 0T  p& 00t@PP@ bP  0nX: dq 0PA) `NP  R(Ѝ00$J$ R= $d@, 4dP$P  P$  !0@P H0$@ P $ 0 PT $P K-SMPp`@ Q00 0 S g0P   0  0S`X@0ЍA-`MAPL PpW^ 0QZ Qu !P S0 sP0QPL UCPA` @TW @W00 p qT  W W  T$QG@$0SB 4P@  P RUPQ 0 0S Q0K C?QPPЍPPUڀ@  0 P R  $ R@Tpp  R @ p Q @ 0 wPwPʟ QSQP 0RU!?\ U 0 #?PQSQPQSQPQSQ PK-T@XMp@xPTp|`@T`PVpP  d@(((d@ 0 X Cp P AT5 40@)D q4 @ H\0T @P d0 A| \x^~10  8P,04$ Pd,PHPQ  $PTT* PPTpYq RPAQ0 P Q tP R@c0 ST | 0HQ    0YPTn  0PTd @X DC0 Tw@P 40dT  @$0$ | 0$0Q ,04x$ P,4 L!d |P{  0(0(d x p3XЍdEp(( X dp(P PpD  PT  0PT H\7  0cPT- LT@ 0v 0P( d `QQ@< YPPPP d@d0\APP> @P 0R0FP5-TPf  ( (0d0TP D PT {D [p00 =0P0 @h  0d!FpK-`@M8 0@nPPUpl Pp7Pt t0,LPY00lt WltP@\.l t0Pg<.plt ,. l0t ,. lt0<  x0lSxP lЍK(0tP l p0 t opPlpt PЍK-`MPTU,( L 1(000 U0 0,0` a8 P@?'^ LX $$?;!8    |~Ll4T@H@@fp 0t 8Q \H0 |`PD`<@@ʠ@0 P@Hpp@ 0q1DQPXUL `@eT` ` V<  @oPkL 80P PP X<L0[PS+a& 0 0iP P 0 R  P9 0 080LL P`R bQ X<0S RdQ HD 0p@ P bP 0  P@0|@ Pc0 S\ ~4PlU8P 80 P4PP $ 4PP4P80t  S0L\ \e, @`p嗴(L 0nKX  p(d a 0@^SW ( =P\0, \d@Xd P= Y8( [A 4Pl4PP| |00V6P<\\`Ѝ00X P0\0SP @! !$=(LP"0@TL1H! ଺d᩺dt\ P hQpA`Ab!◺PT PR@,[4@\PP`Pd\QYt0 t^  x ;P#RPPU   @xP\00U00\` ^ \,C,,Q '&#A`P P\PdA d ^4P"+*P Q  ^+d`P U00\P U0S {\ \TP PxP0 P0UL0 BQ \ [ePbA d 4P"ZPWt[ \ ~ @@hA\@|@\AXADA|$!l 40^3 T1Sv lL R`40D000l Al0 (^`@@T !T P4 A @A到谝,P QT1S  4PU |@T U 0|0 40 hPl @0 0 0 P\T^ h "AXT1  P@A^ 4 P\P P\0 00l0s s 䰝[PPl XP!RLL R Tl 4iXP0,# XLP LDA @@0APD 0L Ro 8PP ~/8 0 g 08D84塹XfD^P0 T1 H[J BQ 4 4  0DQ[P:P 10!( P$?@TA A4H!h%? 8#8        4 0 P$0[0 S" P R4P T2L\ 4t+d)41h4P^h፥h!PTA !  P ~/8 ( 8PH!4E08 TA4T PUz 谝40@DT4b"dP` \ P \$D 0ϸXT˸D0T1PLĸ¸\ XPUl 0 LRR00LX L0S4 L2KPb AQ 0Lb僱 r <1S R! [  0 䰝 0 \pQ LR 1pP U0P/ LA QDA( `Lb ^1  !焰1  LLR``~08D)84o;Xk PD64Xp @X@H @ADP @=00PU2 A4H!D!1TQh^& l0@@4!PA4l P @4 P40@P|PD oPLt n@谝 ,P0P@e L QPՆPPf?^_0PP 嬰10 !0P#P? UP. PU \ \? 0 QPUYP~O8@P@ PH H Pv0 <0ce\@pڸLP@@(01\@0 !8@q !P\ʼ(8 0HPf 4 H000<1P < 0 0R0 P[! ܶP0 0<\d CPL@] P4PP40$l*㺶PP,  0Ȱ < ^ CP@ P 00 0 ! 0 !` H 0 000P[ 0 - ^#ڸP@;   @ T 0傲  !Q(0(4H忶LP@延 @ PRH島屶L寶lH嬶媶P(8 0P  H0P \^à8 (0 P5Q2 H其僶찝[L@P|P @ULu PR2 @Ed 0@1;10101[ v P P\ RXڼ @ 0 P@ @ <` 1T0@0P\ [ [ \^ @ Pἰ`0@<@T 0  P\< c\P$<0@1P@ P 00@1 0 @P` 0 P@ cA@K cTI [Q|\]L !$ R6 0P@  0 Q P0 @@ 0 @ @ T\^L P@ PP:[P0P"; $0P U $Pb 0@@ Bc먰@ ;cP찝[L@PWP @QLNQ谝,  cL$0 @cP0P  @`P 0PP P@ @ b_기@ bPL찝 0 P @b찍G"RY n2S j0@1P@ P 0"> hhv0 0 0 0 !H000^0` QT 0 RX0T `0 S TPx P` QP xRTP`0 0X0^B4H!(00P ^0PP ,谍 0( 0 2S  0S0-~H!840E2f08 fPK- M@0P` @ @ 0pdd p P Ѝ=b 0 lD-40 M 0p3ЍIG-MP,倩 p@(b$`\  @#H $ aPY I @@0 0  0> 0 PЍaPY@ 0 0  0> 0 PhaP# TaP9Y(@ 0 0  0> 0 P'aPYG @@0 0 0> 0 Pl7aPx\}aP HwaP=Y@ 0 0 0> 0 PzYF @@0 0 0> 0 Pep60 0  0 #  PQ<3aP YF @@0 0@ 0> 0 P6` ٲP / `$`  aPY-d@ 0 0 0> 0 P8`P<Y&D @@0 0  0> 0 Pğ 0 0 #  P\ğ 0  0 #  P0`PNY9 0" 030<0 Pß 0 0 #  PTß 0 0 #  Pß0 # 0 #  PwY`P~ S`PkYa|@ 0  0 1> 1 PV4Ÿ 0  0 #  PB 0@ 0 #  P. 0  0 #  PD 0 0 #  P 0 0 #  PY@ @@0 0  0> 0 PP 0  0 #  PxILBTB0@ T0  AD *P&PU 0 P D@@@K-M40p `6 P0R0P0S/ \\ 0  W \  @ ^T\0 UT UP \\ 0 ЍPP PK-M40  @`p P0R0P0S * \\ X  0 \ Q^P 0OPP 0 S% Ѝ PO-MP00U@PP P|0 0P p  Yx@3 @@'X@ X*@A ?D@ 2\ i@]P2XXX\ RXX0@> ʟ < R ~3Q0 0Q0& T @BY 5 0 0p X  P k R$Q$\`V 6Pt0`0PP @%0   @P"@^PQ0 0TP  0PU PP0 0p03S4P @ᑪ0 ፪ Q  R Qc 0S X  PU0S 4P 0 S!HHP "L@T x@T `|Q R6 `Tʀ@ 0P$g 40(0,I|弪 \PUЍ\^ \ <D0QYʁ hPR hPN@ XLTzP 1 0 S RP P \,PzP@ A! x@` 0( 0, 0(0Q , R 5\PT6  M u  P0< aBPp<0 % TQX0P@0X0 U0SDP@PP @0,Vx  0P X0 P Ѝ40 0 R@DBB0D-||@ P @0 0 <0P 0  0d@DBD-|Pp `hPh0@ @`VVP U V聴 FV@DB -LNMH L P! D \QH!<  0#;0<1 L1 Rq@ T r T TT T @1 R@ ]LDQ@ @Q8 0@T<P!\@H o D\0Sh` bAa@D!X!&8<S8AfP0$8X @0 DDS:0K@f U(K 0bT L1 @1 R@ $K R  Dq8QPA` P @` V@P 86`p <p\ X! "PpX!L tL q8!`0S\W D!\0S@@ T pP<PQ P P1@ TPPp0KKH  D\ R s  !p0![P000S  UQ  pp@ <0[P!\@ P1@L 긷P1@% Q$P (> p P L P,TH RP,TTLp@-`@P,T$ $0( S $0, S $00 S 00pK-0M 0S00 $/PXP@q 0[ lS b@@Y( Q l eU`,` `VV 0`,`1pP@K T(-,O$  0@ pP@7U/ E Y@R V` 0   ! V\ 0 `^ @@ \^0 @@l`0Ѝ pR*`R`P,`G Ḁɥ^ P@ 0[ @ A R P @ K-(MHP@ LPT \0$  X`0JVUpT $0 H L`PT(ЍK@(Ѝ{P  T S@   $0 @@@@@-M $(@,0@@ @Ѝ@-M $@(,@@ @Ѝ-M  Ѝ-M  Ѝ0A-@P+ AoB`pP P& 05`00<0<00P@ lS0 PP`P@ `u`3V ei`- C- D-,,M 0 ;Ѝx@-QpM` P6/P 00PP@T 㮤Pp@@ЍQp@-`P@p00@@Q 5/Pp@-QMp`ЍP@U 6/P P@@P@V \ Q` ``0 S`0  p@-0`S@P  6/ P  6/ P  6/p\6/p PQ/0@-@MPP P 5/Ѝ0@蔤P/C-MpX@` PX@ 9/PPЍ@- M `Pp@P  Ѝu 5R000S0/ R0S /p@-`Q1 Q P p0QP U@ U @ Q @UQ 00P ˣ P p 0 0ꫪ@-@P P 00K-M 0  RP  0C@Q P „8  ٣8pQ 0 0p @R@ WD Kȣ@`U T @f@f 0T PWQP  P 0 Ѝ8 [ p800 8080 0 QP00ꁣ 0  O-鬢QMM`K ᪰Pೖ4$ĝTDp0   P,@P$p0?Q0E.(p0]PuKQ@PPPm O~p @ ;iP[ BPXQ\$4RExQ~@'S@PF \/QP(00(0 @ &QP(00(0 QP(00(0 1QP(00(0  QP(00(0 QP(0@0(0  PP(0;(0 |@PP(0;(0EߍۍD PPT4D$EDDDDDE EEDO-鬢QMM`K 7Pೖ4$ĝTDp0   P,@P$p0P0E.(p0PuQ@PPm O~p @ ;P[ 凯PXQ\$4RExQ~@'S@PF \tPP(00(0 @ kPP(00(0 bPP(00(0 1YPP(00(0 PPP(00(0 GPP(0@0(0  >PP(0;(0 |@5PP(0;(0"EߍۍD !PPh4D$EDDDDDE EEDK-`M ⁦P0@L &@P(p80, P@PA@P0D P$`pa04`< A@ApAb00B P4P080O0`ЍK-`M P0@L &@P(p80, P@PA@P0D P$`pa04`< A@ApAb00B P4P080O0`ЍO-ĢM M @M`Pೝ4ŝ08D0N>N> !O>O> "P< N> !O>O> "P< K~n  㪠sS @@@ 3pß #P1 Q pß 0S 〠Uߍۍ@ `V0@T$ß$c /3P ᅬ DB0 L0 )@TPP@ L Pe* ) @ aP `:  @p _`d0 *P3#V00SpV  I@@U0:  d IP \ \00 0w xA @Pp>Ma  %a ! a }P[Q`)0@ꗤ쐟  W)@ 00a  I #L  LX _P U*P  @T PU:L(X DETEE\E|EE--M0 0Ѝ Ѝ/@-XM@ P0ݡ ݥ8 XЍ@-Jp pp0g0 -@-M 00,0K ppЍ@Ѝ/۝g@-Jp ppΝ0g0@-~p pp0g0@-M pp贝0g0@-~p pp觝0g0@-~p pp蚝0g0@-~ pp荝0g0@-Kp pp耝0g0@-KMp@ p@Ѝ␀p0d0@-Kp ppc0g0@-PM@A 1.C-A` ΀0 S/=ɠ -ɠc  /PT \ 0=) -@a 0`0 ЍL l<=)@a =al C@-M@ ݣP 04 ρ00ϠA3l0 ЍMb- `D-<Ѝ-MЍ@-0M@!0ЍD-$$0M @ Ѝt % D- 0M @Ѝ0 %D-鐠P @M0 Pp h X `QrD   ,0Ѝ(XNE$ UD-\\0  [\ :0 \v' P\P8FO-XdM$ p@ 0.47P/$P@)[ K` (T! 0S %SP`  T\ R  R PU@T00 S TdЍ %RP`  OR00ORERP?SP a0@SV%0 A R00 >S, M,000\( (0 Q`S ,0  B l P7P`dP P@4 X 4  ᓛv  40( ``R 40`PH` 2a^3a.^[`f8]?0 B`0` BUPf[o`VYXP\ gY[ `P4/ QZYZ +PP `@D$ R bPPǵRa5of<0 ( l,`pP4 (Q`  ^aP4,  [x ApP | ? `PS`P+ P` p,` PnP = `dd`d P` `4PiP(`VP S(P `NNEFgfff$IQEO-ĤtM`$   0 4Rğ@ : PY p@I 1@P %P <$0 i 0@   ` `%P OP  OPEP? R  Pt aA\pP0AS >Pj00 0S S@A S{  Q_ 00B \QS P00,"0BQJ 00B S PB@v@ @IR 1PBp \LLQPd \vL 0@2 8\%`@{p Ppp  1PN0PolPG kLPpG K\ WHtЍQ['< PlP0`SQRHDP,?p=l`YdpP 0 H l V pWhl` 00 R<0Q< P0 SD P\ ,HY  p ^ AZ0  ޗ0@  @D DPd8l ϫh,F0D-錠 P 0@ 0B0 S ,,00B S0L ^ *$:\R@00h4GO-% @Mℰt T4]@P 0S :S@P FP D PHT`|P `0<R `@>`  V  +S -S 0Qu 0PS 0Q0kV0-S+S X 0C Q0.@─@D RY00 & @&@,RI @MP JP0@ ` [ P ` P05 00C S\0@@T' PeP#P \@b`V /Q P0X0t\8R0 E  @R@0 E G (1(\   1ЍE@P P-R\%`XDql R0<m`PD@P ۡP @TPU0U S C@ @@TP70 0 CE4@\n GP`  `R`F@Pm(4GX$L ,G-Mf0PЍNEO-HHŸ0 @0` Mp , @T@@@BV" <U@İ`@V( VP̑$ B`c !0P/Eb˃❟ e@P`ET0@D00<U@İ`@V0PG^[O@N1 !J?BC! d0nP  0 EQ  $ ( Ѝ3nΠ P X0 EQ0R0 L0b RLlG$IQ|GGD-造P` @tMp P  XDH  ?@00  pЍ(X$ X0 d0"a@-[O #aPK [O@P @Q0D-D0MP 0  xD( @YF 0Ѝ0GO-鬣TM   , WD(0S0@0 @P@TsTcğ^4pãi  0e`@^@@Dv΄P0 pP@0pP2`d@\  ` \ 00R PU @ R4}>PQL@42 DS\ @@[RD$cgFg `%Lp` I@p`ȟ_p P 0`P爑 `p!&@2 >" R0_@P$B >" R0 @_@P 0Q#`a➆(Lp p  L@-Lapp X 0S   l?@P`pWLTЍ00 @0 0 R  , wCLx*QG:O-霣pC4M 0, @ 0P `@`3@*a^* `P ,P ` f P$ `@sCP PUEP 0Y(l(\ Ÿ?cc  PbvN `P@Ϡd2l PcIl PPBQL!1$Γk2k^,Ac<n$0/Cb0 `JSn.`e P MS$ U 0$ `X  =☓!P^U $0JSY;XH \ d4Ѝ0@ SR @`0S:T0@Y0c   Q 00Š0ᑓ B` a X BR!!XA` HPY @  xDQ G,Q$Ip@-`u@Pq 0cp/D- R  #R + R R R  R "R. ^\R   R  L0"S H0 00 S S S  L@D-88@M 0 S   ЍDD-``@` 0XMS  ЍP  ( `DG4O-XXSM 0S DcP 4sL  $C sL@ >P  9CP 0  @ @Q#Q R園P @L P@\  PUE H` AP  00 0.2 AP  00 01 AP   00 0 AP =Q BPP@U0#S% #U# P@  R BP0@0=0 So sm  Q045:@  Ѝ0 S S  PB0@S0u @r P@/D<(X@HG|kGG 0@-MP@P RP ; P 5P0D*<PDHD-@@0p @M-  PЍxpD-鈠`MP @P( ( 0L8S 蠁N\ N8SS S S@PЍp|DD-鸠P` M@P `    @ ˙ PA  - P40 P pЍ`(XD pD-llPl M@`P  H@,0  `Ѝp`(X 0D-lll M@`  L@ PR@,0 Ѝ0t`(XD 0D-\\\ M@L  < $0 PЍ0`(X D-霠 M@`P t0l` p @P 0CȠ\?P ( Ѝ``(XD 0@-P M @P *PP- Ѝ07 Ѝ0@P#/P#/P0 00s03/-00R   00D-餠SM @ \ @ R P  ȠLRЍ  0 9PT000갾 @-P M@@0 @bP ЍD-0SM 0  Ѝ ꨽ - M00 G Ѝ0D-M@\ P6 0t03T T0S0@@P1!Q P  P!0\ \ P@0 PЍ0躐T  ` 0< p@-`p3PPM@\ 0@ @ SP1P!U 0SP   0S \ P  ]ЍpyT  ` - M0# ЍQ R R0B SR S RSP/1S C///][YWUSQ O M K IGpD-XX0M `P@6>P TP RЍp8G0AS@-@PQ @讠@螠pD-XX0M `P@ >P TP RЍpꄹ HD-@P Q00 0  dH- P 0 /ĸ- P 0 /ᐸ0D-MP @P1P P 0  Q+P P Ѝ0-P tP 0`0XD-吡P\ @P RY pa 0 G  R0 0   +R3 -R4 (R' a0 ' p\ `0   0  "0B\  0S)SS pp \P` P0D-蠟M@ PP1\ \ 0   P*\rP0Ѝ0/\aP圎ꬵ0@-PPM  R 10P @ҎP ̎Ѝ0A-pP R`@P0  @S=00dV d2h0P@pD-ؠ` MP @S0P@ 0P@  GT @ഝp0 ` h뭚PPQ@ (ߑꬳHHHHHpD-4P0 `M @0KЍp謲H@-p M`@PM< 0w ЍpD-鄠@ PQM `  P` 0 0QЍp@PP`$bK-M(`p0@$T, @\T) `T' 0PQPPT U@N 0P0@ PQO PT  @ 00`Q VP% @ P0Ѝ"T T Td ezPPᴍP`Pd@@eg@Pᡍ@d``eZ`P  P `ፍ`C-M p0@T T `Q VP @ 00 PЍ `dPPePPWP -L4M@ȤT T P `  PpRp00SR=SK 0S| /S:Sy Sw Su \S P /R:R R R \Rw  PR\_ @nD@?M OLpK0`K0"\+ c 0`[PO00S 80S P T P-:Sx T TZ U ~0~ L@@ Pu3P T@P pTR W`? ~00 ~CP0 `T wP0EP0|3(K|Ÿ DPG T  0PaP0PT P0PTj U` ~~ AP@@ P0u3PPpd``eM`P@PᆌPd``e@`P@zP`=;PP0 }5?MP OLpK0`KS 0"R c 0`PO0P 80S T  T@P PT U` ~ ~0A@@0P`wde`P@/PP Pkd``e`P@P`]lH -PL8M@ D H L0  ( R$K0K P Ҕ@P 6P8 ,oMX<@ `u 0  Pp;P< T7 VV`D0PQ L< H@DpX @ :PPV" T< H<;:98 Y 0@ s3R\- L0 S $ L0S L`0 *SM F$Sx 'S "SJ @P^d T PPP@` 0SLQL/QWUSRQPO8MmKJIHGFEDCBA@?>=s;~9876543210/.,+*)(0^ ^0 Y @PqP3PPUY @ p3RQ 8^JL R z9P6 080 L<^ ,@Yr@@ 4r ~(0$ 8 ,R ӆY 0S8PU Ȇ@\ L^ C9PPY PU@\8QiPY Q@ RP L0P 4 T L0bP8 R ᔆLPUY R 4H P%\ #\ U @!p#*`U:`pL  P 80`Sz 8@P hPPE Uo:L P @i܅PP  48 R080Y K8S E@PrY@@\ R LPx L@\0\C0P@R@LepPd  Lp\SE ~S\ ?S0@T @ ^I T \00 @Y YYDDY Yd0e0巅pPT @P 0P刀 _PP:0`@ ^# T \`@f0Q Q 0 l ]0QZ^XP 0 @aPP 8 RP 0H@0LefPd  Lh0 }R PHHH8%<%tH4PV eI P P @4 @RaPPPU[P rڠ`,0(P$ 0P "P \  @ P P R @7PPv P1 P`Qv0 PbpY P|P3^@@T ,0($ 08 ,R ,PpP3a 0SP @P30PS@ᇄP 00 \@ T 00@ 7QU 8 *<\PPAP(@$P, @Q T $PP($E  ,0PtP3@dpep剄pP& @?Q }QLH@ LH@4 dpepppP  @P %RP@R@H@PH@ 78PU[p PD U ,@MP@{ $(,`75W`Q >4@*5PQp,0$ (0, P W^ \P@3PPpQ@180S JPwP@t0v zd ⇰<IpY  LH@47)P P 0#Q#@L 0@H@H @0LPLpAP  P nd00eƒP (@ LPPLP8P0S  (S )SL0 S \)S0)Q,($ 0A?P8 R ăLP LA6P  8ꄗ  ᯃ Pn 8P ᠃ᝃPpL嘃PLHL^% R^ U @!*@U:L -P @iPP=  28^P8P qP8Py@E Uv:@ L  P 8@^h 5@P V`$ PP(0P,PG @r8PUPo80SPjO-M8 <@|x堫 pT0 P0L8 D 8< R<0PS D@@4kPz t Rt0(0$ t((  R  R R R(0S!*t0S R(0S R PP  R @`@`T 0?T $Tp 'T  *T`@h@lp Tj h,4"T X $T \T p| x`W Vw P@`@pp@`xP@`@`T [ 1P 'TX X@`@`Tx`F,`IPpx|7h0SS H \|0$ l0 00P#[ RI xP e px|\^) @ P@\R*`04P<0凢,exP CY D0S L<TP Ѝ\T [T^ ǟ [1P xQ <Px|@0 @0T<xQ <Xc XKt741Pf sX 4x| @0Y`J4x| @0adPe|P妁PPx p04X,8(x| @0 LP`" m<0Py"T`@0@`TJ 8儀  "T p|0xPW4 U> @ @pp@xP儐@`@`T. $TP \T `TQD8`x| @0`A P ;`T ~TO<@| x@0@ PT *LpFx| @0PF 8({@g\I4O-DKM` zpP@={Kߍ   P @Fύ   H@000  <P Q^ $!P @ P  )P QzP Qp ߆@ @Tf$I4/D-鄠@ 0M`s p P \\\P O~P ( ЍdL(X O-ܡaM Pu ߍ!冟@  4pF  }pH  }PB n(@1⌀pp~p  p|P @/FO~f~ 5P&O_} K( Lr|@P}   {T \ }P {}PDdL(XLI D- QPM `P< HpW, @P \ `@ `\ P@W0Ѝ $P@P L@D  4y@004blI|I (XD-|@0p STMy Ѝ   @@P `4IO-HpHMW `P S $P!@W  Ѝ L@   0 S0cP地@  @r TP0T r P0HP C$P@ýʻ\`I (XbIIID-000 M  < Ѝ^A-PS00@p`>y" P O'U) PpO-H倡,MY PL llql00 @A40S $3/P80 @`$q0 3/ ;/p 7/0Y0   y 03/;/ 007/qx,Ѝ7/"8L@ `(p` ^(X 8O-llll$M ` @Tq pp7/P0`6/(( 0 P5/ @  7/6/0 @5/T%  @00^ VPW T HpLP W  `0  Tw $ЍXh\( 40@-PM@zp0  Ѝ0@<Ѝ0E-Hp堠L`MW @ P P@D  W <0Ѝ(( 0Z (X 0O-H0x4MLPS @ `a` F P Hp `  ;/(9/P 8/P:Ƞ0,(0^   ;/9/ 0B08/ 0*0LPP0WwP 8/4Ѝ4`,p ` pYX( 8- M  ?J ЍD-Hp圠L`MW @ P  `P @0D  W< Ѝ(( 0W (X-M ?P hwK00 ЍQO-hQPM pPJ SH H[8 @`T@  Q45*p ` PL \@ wP@. 0@@ Q45:x!pPVPFR0S0W[ Ѝ \0P L@ D` 4wP00PV (X0 pD-鼠0M @P H`V @ S0 @"p0PV ` ЍpL L @ 4LT 0C0\UD (X- M0 !P Ѝ-HP @ 0S00 {PTItID-鬠0M  ` @HpLP W !Pu  `!pPPW @ Ѝ,, S (X- M "0 !@ Ѝp@-PZv@`庀 Pp0S`p@蒄D-H`嘠MV p @LPtt0  `  00ЍxR(X Q  <Q0   0G-HxMY P`p/ V(0s *R` Y $1ЍWV4@0`p0 -`@ p@@@@u` L@   0X@p`  `bW NuP @piu0`Q (XD-HpXMW P`7 @@vQ*0Q# \;T Ƞ,( 01 < 8`W 0Ѝ ` Q R0A0d L@ X  H0<Q `P P (X-D-44M 0  ЍDЍ/N-0  HN0 --M0 0t Ѝ Ѝ/ -- M 0 t ЍЍ/--M0 07Ѝ Ѝ/--M0 0Ѝ Ѝ/--M 0 OЍ Ѝ/@-p MPp@`K PP @ 0 @T ЍtpD-鰠0M p @0`PhP( 0L  ,@4@8@0@D@ $@ @PiP@ЍLA-PhM@UP!`p 0P(0L ,048D0 @ 0@@$ @0 U \LhЍ0D-|Mx0@ @D0 ᩙP @ڍ0PP$ @Pw$KII0D-xPPM@ @ 0ᅙPP 4U  Ѝ0 "PPJ@- @P0eP @蝘P pD-$$$! M@` P 0 R' U, @T 0U @sP ᝂPsQ Ѝps <0@I(X pD-0LDMwS @ j rS$` Cs0P0H 80|PH$@ l0 0 BP> 1( P aAu@P> (P`6/ wT0P!P@@  ( !006/DЍp2nsv vesOs00 $ v$ Q w vh@T v@TD`DPD  0@@ uhH(X HIH@-M@@D0 \P ڍ蔗P%-$$P  " 0EIE-Hp夠L`MW @ P Q@D  W <0Ѝ(( 0HE (X 0O-H0x4MLPS @ `a` F P Hp `  ;/(9/P 8/P:Ƞ0,(0^  e  ;/9/ 0B08/ 0p*0LPP0rP 8/4Ѝ4`,p ` ptDX( 8D-M0`$!V P?HpW) @V1 00S  $3/P@G0@0@P @W t Ѝ` L@\   DPr@00B (XD-Hp夠L`MW @ P  `P0 @0D  W< Ѝ(( 0A (XG-H`РMLPV @p  00S $-  R  3/PqP 0!V <0Ѝ(( 0@ (X0@-0MP@(RA\ $ ^P   ,0]S Sz -S N @~ B0]STQ !~01SS \!PPYV \1PP<pY @\ 0 ~!\<1 ~/ 1TD-ȠP]Q R^*T  0R !DP?lp P[1S!11 < < H!L`y QXQ8 Hr`tb`x@ P@( $PH@Q ?Vㄒlr P0p⛟U @U 1@ # 0 L@ -TP` eQ QAQ P< 0  Sj  R: "L@Ÿ  2[HM @P 00e@ W , @ P([ Q( R` ((,HBYF 4 ^ @ 0|B儒p` pv`@P (P@!HpW" 4QUb`]HhtS0`M/@P{P  \r L`?< p` : lLP{L@P  00Ѝ0-\ ^ ^0 R 0R\D-霠P M P |@@\AQQT? @@4 @@  Ѝ0@ꐬWDY-  ܫ`0S0@/R- 0S R0 ap@-P` 0R @囼T RP`p吼@卼T:pp 0S\ /0S/S/ 0 S/S/0 R R S 0 S S#3// 0S0/@-@P0 Q Q  \  \P0nCnA0@-MP @K @P Ѝ00RM BS0 0R BS0 aBЍ/0S/ Q`L/@-pRMP`pW 0R @T RP`Ѝ@T3#-0SRL 0S0 0S0  R R 0\  R 0\\/\#3/R/0S R0/Q 0S \ Q `A//-\ ^ ^0 R 0R\ 0S S/- 0\  \n@-0 0RR ^0Pp@-@`P A0S@pP00@TR 0Q/\/ R/R 0 S 0\ R/\#3/R/0 R0/P-R0\0R 0BC0\0R-0\0R/0 R/ 0-^.>00 K00@ 00D-tt0P    Q R @AT!@0J0Y-DMWp3DЍ0/0 S0ã /-0*ASM B RQ010 Ѝ0 :00!0 OJ-0*ASM B R : 00Ѝ7J   JQ  FQ  BQ0@-[,M@ ;Q 0P0    ,Ѝ0- M QP ЍD-餠pM 0`SI@) P QPЍ0S CPp PpI R  td00Qc-?  %"cPQK-Q(M`? QA Q{p3P @P1 P@P PPQ (ЍIKP @PP@ -=R0  0R I00{p p- M "P ЍO-LM `@MPGP= 1@㸐 $iZPPpd`) ZP @! aW: P@P  P ( R0,S Z G P"@  Z@X@T@I@ЍI@$ZD-,,0M @ PЍĝh////@-@m0S ( < 0 G-M m@p@W, < 0\ ( ЍP@P P``@ P `@@n*    <0 0S 3/mH0P p00|/-$0M! Ѝ0@-$@MPHP H$HP HЍ0@HpD-锠$`M @.0 '* P P   P @ 0S 3/Ѝp0ꤛ4[C-P$@Mp0M`PMPP00 PnU@ hGBߍS0D-阠M@ PX%P Ѝ0&P e%P  `%P 0 1'P꼖O-(pQM 9 P= R' G`bbQ@?0P(H" RUS$Ġ $<0? 0I`ϠjV \ Ѝ5MX0jn PfO@  p00F` sHM -LMx t 0 `PPMM KtK0KK 80K8 PPn (KF 0"R c 0 pEPP@00S<p k 0S: XK6KUKm0`\KKP PpK]MM 4`K c 0`/PP@4 R iF0"Q |k` 0 08 0S S nk `gka 0 0 `K80KPPh8K0 `K D @P `Ĕ|[-TT0  0 S R$ / 0<D][]-MjЍ FD- 0 D광t@-j0@ S E0D- M@ `P k0 P@0@ S p S ۍ+@  @@@H[[D- 0 D-,tD- AM@ P`PA ˍ  @WU4PS[#"!/.$8!HqH p4|W@5 ,tP  Aލ$ 4WP@ @D+ JPĝ 0 \ R\@D@PP$/P80$ 4'P[|\[[[<\[$\D- l0 Dčt////0@-M@Pi 0R  0 05/0Ѝ0G-0Mp i`@VP1 @  0  p}& P 00S 3/= $ 0e&X @0Ѝ8  fDP@ P4_O-$\M p 0>iPU @`\ 劝( 0 `- 0   `  P@ P:  0P 1  2/P,  )0`  (``,0 8<`PL  L`V  P\Ѝ`` 0P`  0P,`P  r@-h@T 0S 0@D -L`Mh l p t0 h뤐@Y| @T PV@@p PvGP0S `@MM K`K(pK,`K ,0s8C0"Q2 c 0hp`1BPP@( R 4 0P 0HK 0@LK40lp @TKKP@? l` `pP Ph @ $Kl R @p\hP`@<@ 8` tP P@ `P`2CP  y C0@0uh$00(  ,00/-0L0ML71*)*'" GD8@ D8#D "<@0@@("4̠$ @0@0@0@ @ @@ 0 @0 @8,#4$ <<@8,#4$ <@0@-@MP0S PL0S 3/BЍ0@BbFO-\P P  0,>P PK\#R X0`Q@KZK l0PKO P ,J,\  KL3S KX   P KLJK0@L3KT#\Eh K,@K Kh#0JKd `,\@0K0  @P :KTCK*<@ dA@PX 5P:Kd  ~ *Kh r3 TQRsF[TpdK  BPj6[SfKd \a R]A PZ 0JKSd \  0,@ K< 0JK H80JKSHK<3 JKH#=9C =CS KKH# <3 KH#@CRKDQ , ,=0 00, KXC @K P0,00P  5, ,  ,Mb@w?B00  00/-00MP+@ >`PN;P `8ЍC;0S ``` Pv Vh0`0);MbgD-騠 M@`P  0tpS dpLP  ЍA0 #Lf(X O-H KM >P?<. 1$эAP|9 1$AS$ ` `V @P AP ! 1S Yo;>KߍYD@S.>(S S0e|`,`D`D-88@M 0S Ѝ@:0c0@- M@ PUP P UP!Ѝ0@-PM@ b0P `V | `0#S 0Pp= pP `p@ Q Q` V V ` MppP  R 0S `@ R 0S S S@@  Q Pp Y0P  0P `ЍD-XM n@P 0@@S ЍDPЍaD40D-hP R@P 0PPS 0S 9  00aD40@-M4@P PU P 9P0S PЍ0p@-P@P P 0P `P P@Pp0@-MPP@ @P 0SЍ0 -LHMMM\ ` KPK(K,pKX `0 x9 0"R c 0 p7PP@( R,0s $K8K ;<KX\ `0SKK;E-Р$MoP6$ɘ(I嬂X<3ڢ $ $P<, X @( < >P ;P̠^ =P <*8, 1<DP P1 S `  @   *4p@!71^ 4 xt4\  5;^ ?1 S4T@C  #l1P@g4cAdb%dbccc-MЍ@-0M`SP  Q,0S3Ѝ0S P P  RP Q P P P P $Ѝ@ 0( P 8#4,$ 8,#4 <$P@8,#4$ \ p8,#dĂ < ``@`("4̠$ p8#4,$ 00("4$ 00("4$  R$$8#4,$ 8#4,$ < RO PM 8#4,$ 8,#4$ P28,#4$ P&@8#t,$ <p p@p("4̠$ ̃00("4̠$ 8#Ġ,$ 00,4,Ă  P P^_  P> @P$@: 8#4,$ 0$0,4,Ă < Qt Q^4 P# tojp> {PtP , PjP..D-$$@M P5Ѝ7 R R   0S! S$ S/  00/\ /\ *&" \ \ 00/   00/ 00/ / /00/ / 0 0@- PP 0M@SP Ѝ0 P P P  P Ѝ0@ 0@-M@P P 0S P Ѝ0SЍ0@ Ѝ0@ 0D-hM@ P PЍ0 P (0\ 0L 4$ 0@-M@P P >Ѝ0Ѝ0@>0@-M@PP 0Ѝ0 P 0S0S0 P Ѝ0@ p@-@o.`P1`pC-RPP,M`@ 2pPP0%̠U0(  [1P$ `8@T<T<$,8,#4$ < P $,Ѝ/2.n  $  0@1P0P΄$#!$pP  7P.\  .  @  0 @Q1ꀁU|MbE-((BM 0 5 Q45)*p 0@* PS,P "P1 ȁ0P0\45*pJ P PG P,PD \P 0\45: p 0@Ѝ R4 5: P\45*p "P \P  \45:0 Q45: Q XpXP@` @P PU H1dd -pFMLM `pP24@)3T (K/3@3T 9@P _ hጁ "BD p4P@" GK A@I3P04K.cP 5@D Pf P P -0S ໷YR P PP @^!षP PV P !P  K+1Pt?P ^01@X,P ro牳_0g P P .@P P@e P~\ zD0@,P T.Hd4TEd,d0/@-`RMPpP V,00 @R T@ ,`dVp,Ѝ@-M @P 8#4,$ 0S/8 04 Ѝ@- @4\ ڙP 8 040RP80S 0, R@- @4\ |P 8 040RP80S 8@-`RMp P80SP V 4 R R@1@! nP 4`dVdp4Ѝ0@-@ M 40P,S00@0nSP@ @("4̠$  Ѝ08#4,$ 40, C,4 0@-@ M 40P,S00@0nSʖP@ @("4̠$  Ѝ08#4,$ 40, C,4 A-pR PV @@nT@! `pW `` R00S    P@- @@O- M040 DP@00`P PV@! 0800&lO-|R0 $MP0p"@$Ѝ88@ $2B E R s Rb  @Pd #^ P ` `@P P` R RP U U PdA@P ``g, @ Ġ A0P: `R6 0SP1@ R 0S @ S S@@  \ P00@p| p0p@LP _ @ Z" @PHp(XpiHi i4D-4M 9(0(c/ 0DЍltpD-造 M@tP h \0 `R 80 0( ЍpHp(pX D-頠P M@` P  |00llS p ᡢP  D0Ѝʠp(pXi4 O-`MP pp@P`P p@D 0  0@P^V P Q < 0SЍ`p(X 0D-LM@ P}88 0cO @@ Ѝ0ltO-00QM,`( @@@pP @0 M  D0\P_P 0Q @Q RPW KPQ @ D 0SЍ<p(X 0D-LM@ P88 0cO @@ Ѝ0ltD-88@M 0S ЍcP;$O-\R0 MP0p`"@Ѝ00 Ÿ A  E R㌰]Q R^   ῾@PQ 1#^  0P @P @P U U Q Q @  P> @c*T`P  P@ R 0@S S S@@  \ P@p0@n"@``@ NPa@'*P`<(XiH i4D-4M B(0(c/ 0MЍpD-造 M@tP h \0 `R 80 0( Ѝp`(X D-頠P M@` P  |00llS p ᧠P  D0ЍО(Xi4 O-ȠPMp ``@రP `@ 0  0@PP Q < 0SЍk(X D-@M@ 00c? 0 ЍO-(M qQ @P P p@ 0 [  0s@PsP 0P `jP P  0[@P Q <0 RЍ(X D-@M@ (00c? 0 ЍHD-РqM @Po & PVO@@P[ \ BgS?qߍnN@!mR  1ci0D-造M PP`Ai/ 0@0Ѝ0lPP @$P@@M i@-@\ ^ ^ 0 R  0R\O-<<< M@0r $Ÿ 2 R_ R0SLPf  ~@PW #\ P 威`` @P P`` V VP U U P@P> 004 T P 0S` `p@PU 0S S S@@P VP4vP @ P@ p Ѝf!@ @` `(XiHj4 pD-造 M@tP h \0 `R ś80 0( Ѝp(X<* D-頠P M@` P  |00llS p tP  D0Ѝ蝜(Xj4<* D-鄠pP @P P 0P `P P@P0S}<*D-PPp` P@P 0S PQd|<*pD-, (1M 0R P@ ` 4 R,!0 0 0A^ @`0  R,!0e@Q!Q  QЍp.R V* 0R  xR XR  @- M0p@`P0Q00A S0 !0AQ^@T Ѝ.Q  R T PQ00AT O-P,MP `  P a ,Ѝ    :P006 @ @pT$@P `PP* erW$*D$@PY; RO X b\ N@ 0` P A m :P :T#Y 0S R @T:'pp@T:0'$ p.T\: <P { X v,jO-``$M  0 @  @(q` @ P4 1!" 000E0U n n0 0 0S ` F 4P  0a.` 0@XB`D`P@P@ P  $Ѝ0Q E jQO-pdMP p 0 P a00 dЍ  @  㬿`P0`$\ ` q@@ R \ q v X` Rq v T`v X`@@P:@^V@T v VT T !@TPv @T2@@@@`R: ; VX XT @R0 c. l P x mPQ o$Dj-0P P/0 pD-|PP M p 0`S \@7P ^0 <@A4@ Ѝp`XjYt@-$MP@q`P p 0 @P  0$ЍP@{T@0@p@- M@NPP ` 3 Pb Ѝp@`ZT&00 -LM*P[0(0 @,PK l1( ^@@ ( ,@ PA,T q8pPE X0p : PPPX/ (aB$0̠S3  0U4  `@`V@ X Xi4 0 0$K 0 000  Yi 0p 0@-PM@a@0SQЍ0@V-LL0  0 S Q/ꄾj -L0M`KP8K(pK@ "P0 c 0@H pP@H(P 00 @0  B$K -LM{ `p 쫟 @ RR 0 4@ `0 @ 100  @pT^ ˟ P a00   0^ 0P S ^T 0 0TW  \1M@ 0@  0  0@!$! XI (M@4@ 404 4 P ڔPP ^ 4@  4@T V 4pW <0KPPK8K0 P 尀 & 8 gLP@0 c  R0PP< r PQ8Q? Y ]P U0P^ 0  0 Un 0  ( @ 0 SX    00  Y0 0   ޿0P U`@ P@  X  @0 0 @尀  @ǽ ɽ0'"00P8B?(K ⭽^A?0pWT0 00Խ0p g ╽%PpP@4  P ڔ QQ4@ W  4@?<X% ^w  Rp P<K ["<P4@ R  ,00SN@Q 0K0P @ R  P P  PMP0*0PP  {(M@ 4@ 10Q0 QQ 4  00@8 @4@QQ  400M0 0 0P L\P+4@0S4(M4 ~ K.040 ܼ<@t4 0@^T0SP 0KM 00@ @ (Q>Mp0 @0@ 0  . QQ00)<KP0K8K\ 0 8@tP  a  0 @"P PO 8@t TE p4KTppp4KQ \ Q 0W0  wq,00W0v < KPK8K\ P0 c 0 @ "Pe8@t Tf T0W0 ꔐp4K<0S\ 00S4K@  pQ(M 0p0<p<@@ 0S p<0S"  R @Q(M00 <0<@ P4\P 8@t 0W0 jZ\0lWQ: `( ,4P@  0 @ D0`@P 30X DP ,HЍh T@ DDP+@00+@ Ԓ,(X\* P*O-騡aBM @`MA^p H hAh T1@[V%  W& @ @T50@C 0p妐L  0_ $ЍۍpV+0 0ó RP P@.\ @@D ṵB0tC7+ \,(XH mO-죟샟 @ßcLM(8p `$` (   # 0 @[Vo j Z@,@*0S00P P .SP0SV*R.Q0000@(  0  dA@U345:p$  0H& PLЍ0 4 0@(0  @0@U 0c 0 c 4qm0V0 004 ,p*0 0  DD0Q dP p$  0H P,0oS@ 0S S& S" ( 0@ 0@ Q XP  R000@04 00{  p$  0H Ppʒ k4 gꈏ(,XH pD-XM` @P*<0<@ vϠ 0@@Ѝpt0D-HH H @PC0P(0 0:04mmO-$MP\  LpS `L X0V0$LPV 0 LR ,`L8LV`,@8@OV$P0"@$ЍPs  @P@L2X0 P\ #HPPP`U [P [@ IP@ UP0S 0 S @峊 P  @H@0 0T噊@ P@ H @0 0T[@@@ 0 @ UPP 0 @ P0 @  ꘊ-M   $(00 "Ѝp@-RHMP` R HЍpQ@ .0lX@\`@d@ 0` @Q0D-LMP @(8 80vϠ 0@@Ѝ0萆t!O-LM@ p%bP ߍWT R R7 R TYX000 R- R+ Rg "PR@@ \X :A lbP2 " P0 0BT2 00BT' RK  PQ 9 . eP L 0@  ߲ $,4 噍l13 P  0P @"徲   ല@ 0@@DPA  ᜲuV@UP T P@.\ dX 1 ᄲ 0@H `T@!0T,mdbmmpD-ddd` M@ `L  <40 `( PЍp!(X@" O-ࠟ`p ,M@P ` 0 R P@ 0@ `l @^ T0,Ѝш@Q 0!(D"X@" 0D-造0 M@ Pl  \ 'LH 0,0 Ѝ0(!(X!," 0D-xxx M@ d0 T L L0 PP | ( Ѝ0|!(XD"@" O-錣dMp `WPP P@ 0@@P 0S S s dЍ0SV F\ @FT@@,`FV", 0 0s  @P  0  0 @LP@Ÿ  A!@\1H$ 0@D`P 004H  V*$\0"0Q $$(\( \00w$̮H4 H0SJ401#Q C ZH0H 0``L8 ᦮   \0 0?,(X\* P*O-`|MQ @p᠐ Q`W` @`P 0B P 0S S s |Ѝ0S@Y I\PI@U@"` ᅰ  zpP ` 0 @<0( 04!A 1!4t@d0,0( $@00 4$@0,( @$  0Pp  <7<%@ 0QTt@tTW} 0]t00oQ t  f a P ` t0 0N |(X,\* P*O-M@У`P pᨀP D  ( 㝭W W ЍT 0 @ 4P 0S S0U0 ER E\U}EQz0E, ER4 4048 P,PT O-$$DM @P 0   y8!u䘟 @T ă@T p,0S+:ph0 ,p 0x(DЍX P pXa p稱1, \_  p \LCAX 5 1$ 5:T#P3S$; 0$P,H`# @@k@Tp (`P h3 V  Rh  hl#dÞtQ 0,lSt3 0Wuph0p,08v 04` @Vg p 0  43043 @@ @VV 0X P V% X` { U1, , ^ 0U11: QR: HpA 0TU  h0p000 0 B- `S$ 00@TPF3P1X: pppX@ 40Ap4×p0q03 Q0S ?^\ T,  PUA 04Ãp00`3P[P P P`3 $Qh3 l0h3PPe  P0,PP @ b@,`p V(,` ,`(P`Ð `#(p @(Pf P ,` h3 ^hÅ  K0P0DCDLDC @@X$*  "0sp 0lc 000P3X#dsph3Pt#XPpPpWtspd] q, Q@ Q=  X  0\p\# 7 V03`35f^ Zh f0d(h  "0%p  ``(0p`3rh^ 4 p  ``p   0h\ 0pX p ` ` ,`(60p`T(X$ pD-PM @ aT2 @   @P ` 0 0Ѝp N" \\\  \ 1F@ 00WT(X O-頣pP$M P Q #@tß  d3!u P  G`& $#@\ÙPL0 Pd Vn d 04p 00d#pCfh3t\@pÉTtC@dÉW ^ E|@, T 0  Q* BmP PLT@@ (  F" QwQ00 @Q @   Q00  @  0T0T-  lQ @0@0@( $Ѝ @ @0@@@V* N@P  FPk@ 00 0 0S:@n @,@3dVT(X$ @-p,\CM` `@#0@Tڨ, Pd0U Ѝp Ua h3, 0ah3K- `R 40J  1 C4pQ< PP0  @ 0PM0PJ@  X    p  P @d 0Q.0Q+ , P0X, Y  `R 000`H40(`H3T#D,L\D-PPM = !@   1E0 p Q5``@` @,0^T 0 @2P 0^0^' 1   ЍP e@ 0\0\@ P#d3 `0aBd3PÎP 04  Q:@ ,D Q:H00,p@/p@-̌!J#Z 4 5^ @D!VL 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \CUVp@/!@ Ptp@/@T1/#Z 4 5 4F 5 5Vh ``H@tP^x  10/p1QQP!1/Ɛƒ /  0@-PpC@/-/-3#/-/-/- 3#/ *& *Z>>*SJ51:3//// 2RS"|"!R/.&/* b b<055 320:6//M`-<Ѝ /@-A@/A-Mp`0("@PU` 0`ЍA/A-Mp`0("@PU` 0`ЍA/O-\$M PQ@0P`p Pp S`rp  WPVBV*VV#35!4000 s @ 0b43BR@%  x'x ,8HT*@K*TK2@0@b  `8#8P*0`F*S`F2 VPU*UU#35!3000 s@e6  0k8C13[% l }x'x@$8HT*@H*TH2@0@b V `g 8#8P*`F*P`F20@d%<Mx'x@ $8HT*@I*TI2@0@b&`7 8#8P*0`F*S`F2 qWlW*WW#31 1000 0s0XP!#W*T0 c52@d8B<"0&  (@ $8HT\*@K*TK2@0@b  p8#8P*pG*P0pG2 b .Ƞ%8 8"H 8S  00TP N 0S p$ЍO/lO-M P@S0pP RBR*RR#35!4000 s 0b03rR %l}x'x @ $8HT*@I*TI2@0@bV`g 8#8P*0`F*S`F2 R?PU*UU#35!3000 s@e6  0k7C13[{%p!2x'x@ $8HT*@I*TI2@0@b `8#8P*`F*P`F20 @d %x'x @ $8HT*@I*TI2@0@b` 8#8P*0`F*S`F2 qSlS*SS#31 1000 0s0 WR!#W*T0@ c52 d7B0"0&s p ( p'8HTP*@K*TK2@0@b  p@8#8P*pG*P0pG2 b .Ƞ%8 8"H 8S  P00TP N ЍO/8l/etc/arm_systype%li,%i/proc/cpuinforHardware : %256[^ ] /dev/memioperm: Unable to determine system type. (May need /etc/arm_systype symlink?) Chalice-CATSDEC-EBSA285Corel-NetWinderRebel-NetWinderPWD?function?%s: %s: %d: %s: Assertion `%s' failed.      `  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%s:%d: : %s%s: : %s POSIXLY_CORRECT/..%s memory exhaustedXXXXXX/dev/urandom/dev/randomfile/tmp%.*s/%.*sXXXXXXabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789POSIXC. $VVZ  $(,048%.15s %s[%d]/dev/console[truncated] SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec??? ??? 0 0:0:0 ???? ???J㋌zO????xąy <; "2BB&& %m/%d/%y%Y-%m-%d%H:%M%H:%M:%S()*+Hφ͌zJ&xy ;# 0;<I PcXc,1`5a5`c` %m/%d/%y%Y-%m-%d%H:%M%H:%M:%S()*+/etc/TZTZUTC<<..,M4.1.0,M10.5.0,M3.2.0,M11.1.0<<mUTCGMT""##$$$%%&&/etc/ttysoffsecurewindow/var/run/utmptolowertouppertotitlealnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit@ /bin/sh-c-nc/dev/nullIFS%lluHOME*@$-=?+%s: %s %s: parameter null or not set |&;<>(){}   /etc/group%s:%s:%lu:%lu:%s:%s:%s /etc/passwd/etc/shadow%s:%s:%lu:,%s%s:%s:%lu %ld:: %s%s%m tmpfw+bsh/dev/ttyinfINFnanNAN.,0@p@@ACGO_$@Y@@חA7yACnF?O8M20HwZ?./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz%.*gnan infinityinfnan infinityinf/bin:/usr/binPATH:/bin:/usr/binLOGNAME%s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c --%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' r+/etc/shells/bin/csh/lib/ld-uClibc.so.0) c|c|c|d|  T L h P АĐ̐l4<`4!,4XX&T&\$&$%h+T$d+d+d+%;<==d<t<<;<<=Ed@CEG0H4>lFDD? L KKJLxLhJpLdKpJȘ8hؙ8XКvl0 (  00 pD4`w% 1 T.Loo-@@APePePhPhPkPkEsuu0UTC???0v0T110T10 \E\F\E\E\E\ET10\F\G\F\F\F\F1X11\GL@H4p Dtİܽx/etc/rpcp pp @9㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž3|3|33?GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2JmKDLFQU@VT8W W] W X Xp|^A !__gnu_uldivmod_helper__gnu_ldivmod_helper __divdi3|__udivdi3__clz_tabiJK/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/lib1funcs.asm/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gccGNU AS 2.18iKL/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/lib1funcs.asm/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gccGNU AS 2.18h(LQ/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/ieee754-df.S/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gccGNU AS 2.18h<QU/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/ieee754-df.S/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gccGNU AS 2.18hPUV/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/ieee754-df.S/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gccGNU AS 2.18hdV8W/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/ieee754-df.S/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gccGNU AS 2.18hx8WW/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/ieee754-df.S/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gccGNU AS 2.18c~WW/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/bpabi.S/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gccGNU AS 2.18iG WX/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/lib1funcs.asm/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gccGNU AS 2.18 XXv7vXPXa4v+b5vO6}8vv+PXXa(b)*,&  ^Xint\Sa%b,ef%flowfh#fh#n so llp~ q  M nL dL rpL nnN ddO rrP d0Qs d1Qs n0Qs n1Qs n2Qs q0Rs q1Rs bSs bmSs wws __asWssssss __msus __asssssss __ms)ssssss __msGs __as m1s m0sssssss __mssss$~X^>u#~jv#~c%`uu&vv'rw(~ 1F<2Q\gr}GheB`TYLYNpY ZDm&2>J2j8ZpZ\hf@z \[ \*Hf\P\.:gx\]HShco{ 1 O b u `]]   H :!.1 c^int\Sa%b,efflowfh#fh# n so llp~ q  M nL dL rpL nnN ddO rrP  d0Qs d1Qs n0Qs n1Qs n2Qs q0Rs q1Rs bSs bmSs wws __asLssssss __msjs __asssssss __msssssss __ms<s __as m1s m0sssssss __mssss i _^ c n^/ d^  ^c`;1'FQ\g rT }hr D b   \@^x^ ^L_ F o  ' 3 ??*d__Q]sso{`8a7UsDa|a#*/iac=HAXdp|3QdwbbyH:.i,t c cint\SH:Р%%%%%%%%%% .? : ; ' I@: ; I: ; I 4: ; I$ >  I% $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I : ;I 4: ;I 4: ;I  I&I.? : ;' I@: ;I4: ;I 4: ;I1UX Y1 U414141   I !I/ !4: ; I? < % $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I : ;I 4: ;I 4: ;I  I&I.? : ;' I@: ;I1X Y1 U414141   I!I/ 4: ; I? < % $ > $ > : ; II!I/ 4: ;I?  &I /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armlib1funcs.asmJ//////}.>/0//}./2 ///// /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armlib1funcs.asmK///////////|.>//0//0///|.///2 ///// /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armieee754-df.SL/361////////2//////////3/M//////0/////2/21//////////////2////2///1///1//5/////N/////5//////////////////.///2////2////1///N////1/////N/////N//O/////2//0//1///L1//M/////K//K2/// J////////// J//////2/6///////2/6///////0//1////62 .1/32 .1///0/ ./1/////0////// /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armieee754-df.SQ1//////112//////.//////4/1//////1////1//1////N///////M//21///M////1///////////N//////////N//////////O//////////////////2///1//2///M//////////////22////N//R1//////112//////////12//////1/////1/////////////////////////0/////////2/////1//1//1/////N/////L///3/2///////////////////0//0//// /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armieee754-df.SU/2/301////2/////111/1///1/////////// .//////5/01/R////P////P////P////P///0 /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armieee754-df.SV ///////1////0/0///0/ /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armieee754-df.S8W ////1//////1/1//1////////////1/////1/// /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armbpabi.SW////// /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armlib1funcs.asmW/// /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/armbpabi.cX6Ji/"nfJi/"K /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcclibgcc2.clibgcc2.hlonglong.hXMKK~[.+0&.0NPg--01 XK .wJ.-K,01c1P0,0,5X... fiGJ1+/M+1G1S3)3<vv/'j.J-//M ? /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcclibgcc2.clibgcc2.hlonglong.h^~[J+0&.0NPg--01 XK .wJ.-K,01c1P0,0,5X... fiGJ+0/M+1G13a3<vv/J  /srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcclibgcc2.clibgcc2.h | JL | ,K,L | XXHDD  XPXHDD  | $XpD$ HH | $^D$ H@/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/config/arm/bpabi.c__gnu_ldivmod_helper__gnu_uldivmod_helperlong long intGNU C 4.1.2quotientlong long unsigned intremainder/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/gcc/libgcc2.c__t0__t1__t2__clz_tabhighunsigned charUQItype__q1word_typeUDItypeDWunion__d0__d1complex doubleUSItypeDWstruct__udivmoddi4/srv/poky/autobuild/full-shihtzu/build/build/tmp/work/armv5te-poky-linux-uclibcgnueabi/gcc-cross-initial-4.1.2-r5/gcc-4.1.2/build.i686-linux.arm-poky-linux-uclibcgnueabi/gcccomplex floatshort int__xr__divdi3__q0short unsigned int__r0__r1__udivdi3]}H} PQHp RS WSHWX <PQHL]LP}P} H`PQ`pHTRST`WS`WXhPQ] }$ p}8PQDlPQXRS`RSRSRStRS4pRS8PQPQ PQPQtPQPQ4PPQ,tVW(VWVWttVWxVW4pVWP\PQl|U|VUVPU,4U<pU4V<pVh|X|QXQXQXTpTXttXlR(,R,4X<<p<<l<pR0T8T^pt^^@^[t[[$D[R[[pdQQY,4Y<pYW,4W<pW[,0[HV,4V<pV4T4T,4T<pTdpPpS,,P,4S<<P<@S@RXR,4R<pRQQQY(WXt4V<`T`TP4lRTtX<pXtW<pWtY<pY4tV<pV T<pTP\P\tS<<P<@S,RDtR<pRtxW|QWQW4pQPPPS(4S<@S4T<pT4Y<pY04X<pX$$[(0[4W<pWDpTP<|RR4\<p\P(4P<PPQ(4Q<pQ] }$ }|PQPQDTPQ\PQPQ0LPQT\PQPQ0RSLXRS0dRSRS(8U8`R`DUDLRL UUUVV$8W8HQHPWPXQXWDPQPWTtptTW0WlRWlRpTT@D^,0^^^[|0[[[tR[|[|dHPQXQDXXXDWWWDYYYDVVVTDTTT ,P,DSPSPSRDRRRltQ|QQXWY0VT@TLP(R@tT0XX0WW0YY0VVTT P0SPSR0RR04S8DQDhShQQLTP\PPSSSTTYYXX[[@WW,T\P8RPR\\PPPQQ`<@H`@H< PHLD x|ptl Aaeabi5TEthe 'gets' function is dangerous and should not be used.the use of `tmpnam' is dangerous, better use `mkstemp'This version of __fpending returns bytes remaining in buffer for both narrow and wide streams. glibc's version returns wide chars in buffer for the wide stream case.warning: `siggetmask' is obsolete; `sigprocmask' is bestthe use of `mktemp' is dangerous, better use `mkstemp'.symtab.strtab.shstrtab.hash.dynsym.dynstr.rel.dyn.rel.plt.text.rodata.interp.ARM.extab.ARM.exidx.data.rel.ro.dynamic.got.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges.ARM.attributes.gnu.warning.gets.gnu.warning.tmpnam.gnu.warning.__fpending.gnu.warning.siggetmask.gnu.warning.mktemp44$! %%Q)`w`w11 LL: >C I c c>QССYdp o+|-T.T08848P+8?Pt7+# 0%&( :p0;$P;@6;8J;bp<@z<8<DH#h ˡ4%`wL  cС   + - T.084   p x <4 еص  4< px  d+0 " 0 30  + 0ELSXcu $48<HLP!`` P5X\pHH (4Pd0vpĿ P ",05`>FNV(_Xn~ | <,d"$*|4>F4Rd`r{$ <HHx P x%/@=|IUa o{4d8Lp (&`/p7?JW _\js{(X@ P '<|Ot Y$bq|L $,\ $T /GH [L4q,\(@p #/09`ClQ\ht,\0`P \   4& d/ 9 @ I Q X[ b j u   `   T     H     < P h     0& 2  p= P4G  Q  [ e  Po Xy l     $ , d l     $ , 4 d l     Pd 0  Pg 0  Pj (0 . D Z k  u $ 8   $ ( 0      4         (    T X4/ \4x hB H |(| S `m \ |d n x    `4   dP  Xd    x| X  @$ L$L$ <( m mT( m  (( \)| +X ++ $1 0101 5 m m85 m 5 77 d;l; > > A  A B B BB DD% EL TEhE 40 005 @ F8F IJ hn?R h4I 0K]  p4e @K \Kx dK K K K n L `L x48 n  lL L n n L MM NN O 4 4 4OpO*(PlEPpYQhnlQT QQQRdST,UVHWd Wt  X1Yl:lYDY4Z(]l]{^^```L8abPccdd d$d0$e.eTDpe\Oe \g`r dglg4ghHh8i<tjlk,m$n(p5pCpYxri txtwlPz\z|({|x~  $,$,P$d6hO8 @fHH y̓xD( 0!ܡx9TGXVXj\|ص0ܿD  4   P( r0!.    `p BZit x rz| 5      !!t"Lt""0#### $$$& )%) ,0,<-G`. 01Sd1 44`h4 4 <0i80q55 5T055\0X056 757 0<s |< 80 \0<<=l=== ><>p>'>0>9?BL? p@Lt@ @T@ @^(5iA LBusS s}XBBBB BC C 8C@C CCDpD lDTttD K TtK Pt tPP lQu6tQ V L5DV V x0 `0 uV DY$u*u /u u:F\Y YUZ dZ^hZ ZgZ x^zu  u^ 4bu 0 0 uLbbbb c5c c5c HdXd g55g4h h5000vi i%ii \j0hjThj j;5Gjj PkXk l8l ll @m\m mm n 0 0QnYoaoi(osHo o|L7o z t{N{H{ {T{@{]| |g|8|{~ ,$ ̞  cw cw Hfw fwP mw  mw  | Ը&l75|7A O( d&|858[p i &9$59u @H :: x ;; < м &;5; ̽ܽ &<5=$   ܿ>$>  $?|4>3>3?3d@3@T 4LAd4A'4A74TBtJ4CZ4DDj4Ey4E4lF G4,( 4GtG40H , 4H II4,J `J4,( 4hJhJ4pJX 5JD5 KX-5dKd?5KDQ5 Ldb5pLs5xL$5L , 55LLL L5HL xO 25HO O5HO P5HP LQtQ tRR RR 0TLT T 255TLT T5HT dW 25HW W5H W hX5HX 4Y\Y 0ZLZ ZZ [[ @\ 26L\ (]0] ] 66]d] p` H6 I6I$6I(6$I46X` 4aTa b:6(b bG6b cT6$c \d_6f6dddd gq6~6h6g|g ii k6k k6, 6, k ll6  , 6l6o p6, , 66pp6p  |7I 70P} !72&7I  2 047 ?7 8D `L7Ih ā X7Ia7i7`t7~7 x77 Ą7I7̄77,7h7P7 77̈8888 %8(/898܋ d JE8 JH8 3 3K8\8  3n8d @88h 8K8$J8 88d   8Ȣ ,8M8L88  Ħ8̦9#9 49O;9MD9 hR9|  O_9P k9P {9O9P D9d 9 9 99 9t999:::$:X-:::C:J:0U:h_:f:p:y:<:|::: 0:(38 T:,3\  (3::::P:|;;; (;@5;9U;H_;k; u;;; ;T ;$;P;;4;p;;4;;<|  03< $< .<5< , \C<d PN<h X< 4P c< 0 H3k<P H3<D <<<7 <<0<8<<  `3<3 `| ,  `3 3<x3< < ( DH <@  =  P=P  h$= 8-=H3=|:=B=` J= DT=H P `=Pl=v= = = ==, \=d=p == ==( t=x = > > l>p $>P->>> <E>XM XP>D W>Pc>@ n>z> >> >$> >>>>>>> > > >???$? X7?`>?h F?PQ? Z?Pe?(n?8y?`???d ? ? ? ? ? ? ?P @X  @"@5@>@G@(Q@0 @`@o@( @ t x@ 0 4@P@ @ T@ @\ @@L @@@, L@T @8A A! " " \"d" "A'A"" \-0AQ(- ,4> <>D> x>> >> >> ,?4? h?p? ?? ?? @$@ X@`@ @@ @@ AA HAPA AA AA AA 0B8B `BhB BB BB BB (CA0C \CAhCB%BtCtC D(D dDpD D4BTRD FNB[BF\F DGlB\RTG HBXRH HH $I0I lIxI II JBJ   &K , L SLQUV8WWWBX X BX ^ B^ c B Р B0BbBtoDBo BIPB0CpTCȢp&C<5C0DCm8PCtQLaCZrCS~CzCCp C C(PC@CC0CPjDd;8)D83DH>D <JDP0[DKiDt4vD D,0D ~D48Dm4D8dD(DHDhDt E *E0(E@<=E<IE[E`lEO|E(EtEd0EXEd|E0E4ETETXFOF#  FpX-F<@=FOF$^FXlFxFrFP0F\FPF`dF-FhCFtDFGG(^ G\/G X:G-HGmZG>\jG{$xGD<GhGpDxGaG4GtQG8GG HH'H6\5HHFHL`SHaHoDJaH]ara aLa}<a6 aDa$8aD0apaV0a,4 a0bX b0+b(89bcLOb\m]b30ibswbhLb`S,bLbh4bQbPbblb^4bc0cX*c(=cDKcTTWc ich4vclLtcco(c[,cQ0cT.c-lc\xHcX d$Xd$c@*d06dt@d" NdZWd@fdt>rdwl~dddxd4d84d0d8 dpDdп8e e@d(eth4eBepLRe0_edgHie0veEeeSe qqeeptHede0eReff$}'f 4fS(Kf,Zf of4yf,,ff0ff$hf,|fSfl0f \flCgX !gL6gFgRg40^gytlg|gg gp4g(g 6g,<ggp@gg |hphLl$h:h@IhTh̄$ch0hwhth h8dhvhVlhu4h@K$hp-h0hh3 iDi882ihD>i7Ki Ui4biTTnit~i`iOi$uXiX4iHHi,i,i j0m`j$%j|X2jl;<l0"l ll(|lTEld30llllOLlytlP`m(0m8lmd")m(t0mH07m=m4EmLLm0Sm$\m<cmnmDtm8m4mD5md mLm(mD0m܊m5m|mPm|0 n!$n4`"n:<7n4"r@<JrsSrXr 0drTVtr4rsror0r0r pr\rdr:Lr,r0r[Xr8$s3s<4$s><:s4$Js9xVs0"]sP0is$ss`0s\.s$ss$sd0s0ss430sPs{s0s60s(^sssttzt"-tB0"BtHLt$TtpT"\tbt nt0ztOtdfpt<t0t>@t=4tDtPl t0tHt8V4tpDttLt4u0u,P(#ul;(uDP6ud=u88MuUUu3@Zu"`u0iuLZu\<u?<uuTu(u4u0uu 0u$u@vHL vovv#vT4,v .4v48y00Kyd[yLiy4|y(yBy y04yly0y\0yL?(y`$yxy4y\<"yd<yB0"z0z(z, /z07z0>z<FzD0Oz0Yzfz0tz8dz,z$Zz0zzT4zl@z;<ztC0zV{L{#!{0.{H:{o B{OI{,,R{|"Z{,0j{<x{TP@{0{S {40{`d{X{L{H{ {P{xd{f4 |x|8( |.|d5|LB|QO|H_|0"e| m|<w||DR|0|d|C|x||4d|00||r||t}l }}00}*}^4}4"9}HxG}<R}} _}%p}lz}^4}|}`}`(}W}P$}@}X }<<}tQ~l0~ȃT~xd(~x0/~85(6~C ?~4F~8L~lX~_q~4 ~~H~@~|X~ ~/4~P~,~ ~0~P0~XD~~~ P0 L`D#L20:vB4IpSbd`6kh\q8W}000sС 4"\h8[x`?<8L4h X$<< $8+,02$> JA<a1kc|u4wPp{$00"0 Aπt4׀,ހ "X,0TPPA<"," (h0.\08<C 4JH3 Y0xlwPspod< X`.0 Ł=<ށ=<0",<4 `` DR!(,$1h8l4C$XI0S40[8e3sL0La8sUB|\ȂH؂t:x4,Pq(lX4(38F(PMM\YPtfWLr4P0m̄$0"$ @0ɃL<Ӄ0ۃ`ZPD>< m0!D(K50;|50D P(<<m`x $ XE0 0ʄXD"؄H>4)<@T,x$  <'$@<=<EPK4PT`blLtn<>4uL~`V}@0,4(m8Dž _4000 X<"!0)D4VClV<d|l Hr"dx000ΆLۆCXpH@RH5~XN\xH&\/<slyH#d$ptHP  9xPъ l,؊0ߊ@$080 yd),85hD<0"A4<H30O,(UM_&g@oHDxpX4tS  t00g4‹0ϋ?4֋"п8 pDxQ T/0= "EL Ox$Wbm8tP0S\Y7P`x0$c@Ď03ڌDC0hd"T <0h\X"D87@KqQtYhB0"u $00p 84AT\ƍ-$͍,0֍@d C4Yhpl <'0+z>PH|(,L@W| ]Wd<k0rHx,~0]HH(PT9pDĎJҎtlَDM0$|hD <"8W, U42,? E$O(HY0a,pk{0Rd$Pg:(ʏ08ڏ8ߏ$ x0P`,J< Pl@#,+p>420"70?LXL[<4`h|<0o@wP@$|$ 0_L50@ɐtѐp8ِl-\k@s0@Z ><dQ7=<ܛ,D_ O ,)(\(/D8B8?wlFo L0T4`T\h\ov@<0m`L`"4@d" 089LʜPМ4Tڜl8TV6L0U< XB4%0*9TAJS]PXHrdgHz<H4np q\m$sTP@RÝxXҝ0۝TT0<< h0L&(t.\07`0>|XLPW8`0mL0rTa|VE  :$L(lʞ0Ӟ;<h4"4`r  &X1 <4Nl"TV0Z,0ff4v`0}0L4WL\hLp?<ןpH"ߟز8$ d|<$(8*89pLD$0T>4[,j\Ht(|DpP<"0"D04d<<ؠt>ߠXd@ H(TX%$/,7p-A4"LlXSY `pm,rL/x~\4`X4(o  tld@brk.c$a$dioperm.cioplatformiobase_name.3951ioshift_name.3952iopl.cmmap.cposix_fadvise.cposix_fadvise64.csigaction.c__syscall_error.caeabi_assert.caeabi_atexit.caeabi_errno_addr.caeabi_localeconv.caeabi_memclr.caeabi_memcpy.caeabi_memmove.caeabi_memset.cfind_exidx.cfind_exidx_callbackaeabi_mb_cur_max.c__error__rt_sigtimedwait.c__rt_sigtimedwait__socketcall.c__syscall_fcntl.c__syscall_fcntl64.c__syscall_ipc.c__syscall_rt_sigaction.c__syscall_sigaction.c_exit.caccess.cacct.cadjtimex.calarm.carch_prctl.cbdflush.ccapget.ccapset.cchdir.cchmod.cchown.cchroot.cclock_getres.cclock_gettime.cclock_settime.cclose.ccmsg_nxthdr.ccreat64.ccreate_module.cdelete_module.cdup.cdup2.cepoll.cexecve.cfchdir.cfchmod.cfchown.cfdatasync.cflock.cfork.cfstat.cfstat64.cfstatfs.cfsync.cftruncate.cftruncate64.cget_kernel_syms.cgetcwd.cgetdents.cgetdents64.cgetdirname.cgetdnnm.cgetdtablesize.cgetegid.cgeteuid.cgetgid.cgetgroups.cgethstnm.cgetitimer.cgetpagesize.cgetpgid.cgetpgrp.cgetpid.cgetppid.cgetpriority.cgetresgid.cgetresuid.cgetrlimit.cgetrlimit64.cgetrusage.cgetsid.cgettimeofday.cgetuid.cinit_module.cinotify.cioctl.ckill.cklogctl.clchown.clink.cllseek.clongjmp.clseek.clstat.clstat64.cmadvise.cmincore.cmkdir.cmkfifo.cmknod.cmlock.cmlockall.cmodify_ldt.cmount.cmprotect.cmremap.cmsync.cmunlock.cmunlockall.cmunmap.cnanosleep.cnice.cnoophooks.cntp_gettime.copen.copen64.cpause.cpersonality.cpipe.cpivot_root.cpoll.cppoll.cprctl.cpread_write.c__fake_pread_write64__fake_pread_writepselect.cptrace.cquery_module.cquotactl.cread.creadahead.creadlink.creadv.creboot.crename.crmdir.csbrk.csched_get_priority_max.csched_get_priority_min.csched_getaffinity.csched_getparam.csched_getscheduler.csched_rr_get_interval.csched_setaffinity.c__kernel_cpumask_sizesched_setparam.csched_setscheduler.csched_yield.cselect.csendfile.csendfile64.csetdomainname.csetegid.cseteuid.csetfsgid.csetfsuid.csetgid.csetgroups.csethostname.csetitimer.csetpgid.csetpgrp.csetpriority.csetregid.csetresgid.csetresuid.csetreuid.csetrlimit.csetrlimit64.csetsid.csettimeofday.csetuid.csigaltstack.csigpending.csigprocmask.csigqueue.csigsuspend.cstat.cstat64.cstatfs.cstime.cswapoff.cswapon.csymlink.csync.csysctl.csysfs.csysinfo.ctime.ctimes.ctruncate.ctruncate64.culimit.cumask.cumount.cumount2.cuname.cunlink.cuselib.custat.cutime.cutimes.cvhangup.cwait.cwait3.cwait4.cwaitid.cwaitpid.cwrite.cwritev.cxattr.cxstatconv.c__assert.cin_assertisalnum.cisalpha.cisascii.ciscntrl.cisdigit.cisgraph.cislower.cisprint.cispunct.cisspace.cisupper.cisxdigit.ctoascii.ctolower.ctoupper.cisblank.c__C_ctype_b.c__C_ctype_tolower.c__C_ctype_toupper.c__ctype_b_loc.c__ctype_tolower_loc.c__ctype_toupper_loc.c__ctype_assert.cisctype.calphasort.cclosedir.cdirfd.copendir.creaddir.crewinddir.cscandir.cseekdir.ctelldir.creaddir_r.creaddir64.calphasort64.cscandir64.creaddir64_r.cerror.cold_line_number.2469old_file_name.2468err.cvwarn_workfmt.2453lockf.clockf64.cfnmatch.cend_patternposixly_correctext_matchinternal_fnmatchftw.cobject_compareprocess_entryftw_dirftw_startupnftw_arrftw_arrftw64.cglob-susv3.cglob64-susv3.cobstack.cprint_and_aborttempname.cdirexistslettersvalue.3305errno.c__errno_location.c__h_errno_location.csetlocale.cC_stringlocaleconv.cthe_lconvdecpt_locale_init.cnl_langinfo.cnl_datamntent.cmylockbuff.2488mnt.2489regex.cre_string_construct_commonre_string_translate_bufferre_node_set_comparere_node_set_containsre_node_set_remove_atoptimize_subexpscalc_nextpeek_token_bracketmark_opt_subexpcheck_dst_limits_calc_pos_1check_dst_limits_calc_posfind_subexp_nodesearch_cur_bkref_entrycheck_dst_limitspreorderpostorderparse_bracket_elementcreate_token_treeduplicate_treecreate_treelower_subexplower_subexpsre_node_set_init_1link_nfa_nodesre_node_set_allocmatch_ctx_cleanfree_fail_stack_returnpop_fail_stackfree_charsetfree_tokenfree_treefree_workarea_compilefree_statefree_dfa_contentutf8_sb_mapre_string_destructre_node_set_insert_lastregister_statere_node_set_insertcheck_arrival_expand_ecl_subre_node_set_mergecheck_arrival_expand_eclre_node_set_add_intersectre_string_realloc_bufferssift_ctx_initsub_epsilon_src_nodesre_dfa_add_nodeduplicate_nodeduplicate_node_closurecalc_eclosure_itercalc_firstre_node_set_init_copyre_node_set_init_unionbuild_wcs_bufferpeek_tokenfetch_tokenfetch_numberre_string_context_atcheck_node_acceptcheck_halt_state_contextbuild_wcs_upper_bufferbuild_upper_bufferextend_buffersclean_state_log_if_neededre_string_reconstructcheck_subexp_matching_topre_acquire_state_contextre_acquire_stateexpand_bkref_cachemerge_state_arraycheck_node_accept_bytescheck_arrivalget_subexp_subtransit_state_bkrefmerge_state_with_logsift_states_backwardupdate_cur_sifted_stateset_regsre_search_internalre_comp_bufbuild_charclassbuild_charclass_opparse_expressionparse_reg_expC.203.6867parse_branchre_compile_internalre_compile_fastmap_iterre_search_stubre_search_2_stubhsearch.chtabtsearch.ctfind.ctdelete.ctwalk.ctrecursetdestroy.ctdestroy_recurselfind.clsearch.cinsque.cremque.chcreate_r.chdestroy_r.chsearch_r.cstatvfs.cfstatvfs.cfstatfs64.cstatfs64.cstatvfs64.cfstatvfs64.csyslog.cLogMaskcloselog_internLogFileconnectedLogStatLogTagLogFacilitysigpipe_handlerSyslogAddrtruncate_msg.4105ftok.csemget.csemctl.csemop.cshmat.cshmctl.cshmdt.cshmget.cmsgctl.cmsgget.cmsgrcv.cmsgsnd.cadjtime.cftime.casctime.c__time_strasctime_r.cat_dataclock.cctime.cctime_r.cgmtime.cgmtime_r.clocaltime.clocaltime_r.cmktime.cstrftime.cload_fieldspecstrptime.ctzset.cgetoffsetvalsoldval.3787_time_t2tm.c_valsdaysutc_string__time_tm.c_time_mktime.cdysize.ctimegm.c_time_mktime_tzi.c__vals_time_localtime_tzi.cday_corll_tznamedifftime.cwcsftime.cgetttyent.cskipzapchartfline.2569ttyutent.cutmplockstatic_fdstatic_ut_namedefault_file_name__setutent__getutentstatic_utmp__getutidwtent.cbtowc.cwctob.cmbsinit.cmbrlen.cmbstate.2621mbrtowc.cmbstate.2622wcrtomb.cmbsrtowcs.cwcsrtombs.c_wchar_utf8sntowcs.c_wchar_wcsntoutf8s.cmbsnrtowcs.cwcsnrtombs.cwcwidth.cwcswidth.ciswalnum.ciswalpha.ciswcntrl.ciswdigit.ciswgraph.ciswlower.ciswprint.ciswpunct.ciswspace.ciswupper.ciswxdigit.ciswblank.cwctrans.ctransstringtowctrans.cwctype.ctypestringiswctype.cdesc2flagtowlower.ctowupper.cwordexp.ceval_expreval_expr_multdiveval_expr_valw_addmemexec_comm_child_itoaw_addstrw_addwordparse_qtd_backslashparse_backslashparse_tildeexec_commparse_backtickparse_arithparse_dollars__parsegrent.cgr_off__parsepwent.cpw_off__parsespent.csp_off__pgsreader.cfgetgrent.cresultbuf.2684buffer.2683fgetgrent_r.cfgetpwent.cfgetpwent_r.cfgetspent.cfgetspent_r.cgetgrent.cgr.2684line_buff.2683getgrent_r.cgrfgetgrgid.cgetgrgid_r.cgetgrnam.cgetgrnam_r.cgetpw.cgetpwent.cpwd.2684getpwent_r.cpwfgetpwnam.cgetpwnam_r.cgetpwuid.cgetpwuid_r.cgetspent.cspwd.2684getspent_r.cspfgetspnam.cgetspnam_r.cinitgroups.clckpwdf.cnoop_handlerlock_fdputgrent.cformat.2683putpwent.cputspent.c_sp_offld_format.2684sgetspent.csgetspent_r.cfclose.cfcloseall.cfdopen.cfgetpos.cfopen.cfreopen.cfseeko.cfsetpos.cftello.cgetdelim.cgetline.cgets.c__evoke_link_warning_getsgetw.cperror.cputs.cputw.cremove.crewind.csetbuf.csetbuffer.csetlinebuf.csetvbuf.cungetc.cprintf.cvprintf.cvsprintf.cfprintf.csnprintf.cdprintf.casprintf.csprintf.cvasprintf.cvdprintf.cvsnprintf.ctmpfile.ctmpnam.ctmpnam_buffer__evoke_link_warning_tmpnamtmpnam_r.cpopen.cpopen_listtempnam.cctermid.csbuf.3947fgetpos64.cfopen64.cfreopen64.cfseeko64.cfsetpos64.cftello64.c_READ.c_WRITE.c_adjust_pos.c_fopen.c_fwrite.c_rfill.c_stdio.c_stdio_streams__stdio_mutex_initializer.3961_fixed_buffers_trans2r.c_trans2w.c_wcommit.c_cs_funcs.c_load_inttype.c_store_inttype.c_uintmaxtostr.c_fpmaxtostr.cexp10_tablefmtexp16_table__fbufsize.c__flbf.c__fpending.c__evoke_link_warning___fpending__fpurge.c__freadable.c__freading.c__fsetlocking.c__fwritable.c__fwriting.c_flushlbf.cfopencookie.cfmemopen.cfmo_seek_fmo_io_funcsfmo_closefmo_writefmo_readopen_memstream.c_oms_io_funcsoms_closeoms_seekoms_writeflockfile.cftrylockfile.cfunlockfile.cvfprintf.c_charpad_fp_out_narrowspec_base.4191prefix.4192_ppfs_init.c_ppfs_prepargs.c_ppfs_setargs.c_ppfs_parsespec.c_promoted_sizetype_codestype_sizesspec_flags.4197qual_chars.4202spec_chars.4198spec_ranges.4199spec_or_mask.4200spec_and_mask.4201_bss_custom_printf_specregister_printf_function.cparse_printf_format.cvfscanf.cscan_getwcsc_getc__scan_cookie.cdecpt_str__psfs_parse_spec.cspec_flagsqual_charsspec_charsspec_rangesspec_allowed__psfs_do_numeric.cspec_basenil_stringnan_inf_str.4371scanf.csscanf.cfscanf.cvscanf.cvsscanf.c_wfwrite.cfwprintf.cswprintf.cvswprintf.cvwprintf.cwprintf.cfwide.cungetwc.cvfwprintf.cspec_base.4247prefix.4248invalid_wcs.4201_fp_out_widewscanf.cswscanf.cfwscanf.cvwscanf.cvswscanf.cvfwscanf.cfake_decpt_strclearerr.cfeof.cferror.cfflush.cfgetc.cfgets.cfileno.cfputc.cfputs.cfread.cfwrite.cgetchar.cputchar.cfgetwc.cgetwchar.cfgetws.cfputwc.cputwchar.cfputws.cclearerr_unlocked.cfeof_unlocked.cferror_unlocked.cfflush_unlocked.cfgetc_unlocked.cfgets_unlocked.cfileno_unlocked.cfputc_unlocked.cfputs_unlocked.cfread_unlocked.cfwrite_unlocked.cgetchar_unlocked.cputchar_unlocked.cfgetwc_unlocked.cmunge_streamgetwchar_unlocked.cfgetws_unlocked.cfputwc_unlocked.cputwchar_unlocked.cfputws_unlocked.cLalignedLlastwordmemchr.cmemmem.cmempcpy.cmemrchr.crawmemchr.cstrcat.cstrchr.cstrchrnul.cstrcpy.cstrcspn.cstrncat.cstrncpy.cstrnlen.cstrrchr.cstrsep.cstrspn.cstrstr.cstrtok_r.c__glibc_strerror_r.c__xpg_basename.cnull_or_empty.1080__xpg_strerror_r.cunknown.1101_string_syserrmsgs.c_string_syssigmsgs.cbasename.cdirname.cnull_or_empty_or_noslash.1080ffs.cmemccpy.cpsignal.cstpcpy.cstpncpy.cstrcasecmp.cstrcasestr.cstrdup.cstrerror.cbuf.1088strlcat.cstrlcpy.cstrncasecmp.cstrndup.cstrpbrk.cstrsignal.cbuf.1778unknown.1779strtok.cnext_start.1078sys_errlist.csys_siglist.cwcpcpy.cwcpncpy.cwcscasecmp.cwcscat.cwcschr.cwcschrnul.cwcscmp.cwcscpy.cwcscspn.cwcsdup.cwcslcpy.cwcslen.cwcsncasecmp.cwcsncat.cwcsncmp.cwcsncpy.cwcsnlen.cwcspbrk.cwcsrchr.cwcsspn.cwcsstr.cwcstok.cwmemchr.cwmemcmp.cwmemcpy.cwmemmove.cwmempcpy.cwmemset.ccfmakeraw.ccfsetspeed.cspeedsisatty.cspeed.ctcdrain.ctcflow.ctcflush.ctcgetattr.ctcgetpgrp.ctcgetsid.ctiocgsid_does_not_work.1847tcsendbrk.ctcsetattr.ctcsetpgrp.cttyname.cdirlistname.2048auth_none.cauthnone_verfauthnone_validateauthnone_refreshauthnone_destroyauthnone_marshalopsauth_unix.cauthunix_nextverfauthunix_marshalauthunix_destroymarshal_new_authauthunix_refreshauthunix_validateauth_unix_opsauthunix_prot.cbindresvport.cport.2281clnt_generic.cclnt_perror.crpc_errlistrpc_errstrfree_mem_bufauth_errstrauth_errlistclnt_raw.cclntraw_geterrclntraw_abortclntraw_controlclntraw_destroyclntraw_freeresclient_opsclntraw_callclnt_simple.cclnt_tcp.cclnttcp_geterrclnttcp_freeresclnttcp_abortclnttcp_controlclnttcp_destroyreadtcpwritetcptcp_opsclnttcp_callclnt_udp.cclntudp_geterrclntudp_freeresclntudp_abortclntudp_controludp_opsclntudp_destroyclntudp_callclnt_unix.cclntunix_geterrclntunix_freeresclntunix_abortclntunix_controlclntunix_destroyreadunixwriteunixunix_opsclntunix_call__msgwritecm.4745create_xid.cis_initialized__rpc_lrand48_dataget_myaddress.cgetrpcent.c_rpcdatarpcdatafirstwhite__get_next_rpcentRPCDBgetrpcport.cpm_getmaps.cpm_getport.ctimeouttottimeoutpmap_clnt.c__get_myaddresspmap_prot.cpmap_prot2.cpmap_rmt.crcmd.c__ivaliduser2iruserfopeniruserok2rexec.crpc_cmsg.crpc_commondata.crpc_dtablesize.csize.3878rpc_prot.creply_dscrmrtime.cdo_closeruserpass.ctokencfiletokvaltoktabtokstrsa_len.csvc.csvc_findsvc_auth.csvcauthsw_svcauth_nullsvc_authux.csvc_raw.csvcraw_statsvcraw_destroysvcraw_freeargssvcraw_getargsserver_opssvcraw_replysvcraw_recvsvc_run.csvc_simple.cuniversalsvc_tcp.crendezvous_statsvctcp_getargssvctcp_freeargsmakefd_xprtsvctcp_opsvctcp_destroysvctcp_replysvctcp_statsvctcp_recvsvctcp_rendezvous_opsvctcp_rendezvous_abortrendezvous_requestsvc_udp.csvcudp_statsvcudp_getargssvcudp_freeargssvcudp_opsvcudp_destroysvcudp_replysvcudp_recvsvc_unix.csvcunix_getargssvcunix_freeargssvcunix_opsvcunix_destroysvcunix_replysvcunix_statsvcunix_recvcmsvcunix_rendezvous_opsvcunix_rendezvous_abortxdr.cxdr_zerocrud.3317xdr_array.cxdr_float.cxdr_intXX_t.cxdr_mem.cxdrmem_opsxdrmem_destroyxdrmem_getlongxdrmem_putlongxdrmem_getposxdrmem_setposxdrmem_inlinexdrmem_getint32xdrmem_putint32xdrmem_putbytesxdrmem_getbytesxdr_rec.cxdrrec_inlineflush_outxdrrec_putint32xdrrec_putlongfill_input_bufskip_input_bytesfix_buf_sizeget_input_bytesset_input_fragmentxdrrec_getbytesxdrrec_getint32xdrrec_getlongxdrrec_putbytesxdrrec_destroyxdrrec_opsxdrrec_getposxdrrec_setposxdr_reference.cxdr_stdio.cxdrstdio_opsxdrstdio_inlinexdrstdio_putint32xdrstdio_putbytesxdrstdio_putlongxdrstdio_getint32xdrstdio_getbytesxdrstdio_getlongxdrstdio_destroyxdrstdio_setposxdrstdio_getposgetservice.c__initbufservbufservfservserv_stayopengetproto.cstatic_aliasesprotofprotoproto_stayopenhostid.cgetnetent.canynetflinenetnet_aliasesNETDBgetnetbynm.cgetnetbyad.cinet_net.cntop.cinet_pton4xdigits.3079.LC0inet_ntop4herror.cerror_msgh_errlistcolon_space.2734if_index.cgai_strerror.cvaluesgetaddrinfo.cgaih_inet_servgaih_inetnullservgaih_inet_typeprotogaihdefault_hintsin6_addr.cether_addr.cresult.2680asc.2705ntohl.copensock.cifaddrs.cinet_aton.cinet_addr.cinet_ntoa.cbuf.2649inet_makeaddr.cinet_lnaof.cinet_netof.cencodeh.cdecodeh.cencoded.cdecoded.clengthd.cencodeq.cdecodeq.clengthq.cencodea.cdecodea.cdnslookup.cnsidresolveaddress.copennameservers.cclosenameservers.cresolvename.cgethostbyname.ch.4907buf.4908res_init.cres_query.cgethostbyaddr.ch.4909buf.4910read_etc_hosts_r.cget_hosts_byname_r.cget_hosts_byaddr_r.cgethostbyname2.ch.4908buf.4909getnameinfo.cgethostent.c__stay_open__gethostent_fpbuf.4942h.4941gethostbyname_r.cgethostbyname2_r.cgethostbyaddr_r.cres_comp.cns_name.cencodep.cdecodep.cformquery.caccept.cbind.cconnect.cgetpeername.cgetsockname.cgetsockopt.clisten.crecv.crecvfrom.crecvmsg.csend.csendmsg.csendto.csetsockopt.cshutdown.csocket.csocketpair.callocrtsig.ccurrent_rtmincurrent_rtmaxkillpg.craise.csigaddset.csigandset.csigblock.csigdelset.csigempty.csigfillset.csiggetmask.c__evoke_link_warning_siggetmasksighold.csigignore.csigintr.csigisempty.csigismem.csigjmp.csignal.csigorset.csigpause.csigrelse.csigset.csigsetmask.csigsetops.csysv_signal.csigwait.cmalloc.c__malloc_largebin_indexcalloc.crealloc.cfree.c__malloc_trimmemalign.cmallopt.cmallinfo.cabort.cbeen_there_done_thatgetenv.cmkdtemp.cmktemp.c__evoke_link_warning_mktemprealpath.cmkstemp.crand.crandom.cunsafe_staterandtblrandom_r.crandom_poly_infosetenv.clast_environsystem.cdiv.cldiv.clldiv.cgetpt.cptsname.cdevpts.3237buffer.3256grantpt.cunlockpt.cdrand48-iter.cjrand48.cjrand48_r.clrand48.clrand48_r.cmrand48.cmrand48_r.cnrand48.cnrand48_r.crand_r.csrand48.csrand48_r.cseed48.cseed48_r.cvalloc.cpagesizeposix_memalign.ca64l.ca64l_tablel64a.cresult.1450conv_tablemkstemp64.cdrand48.cdrand48_r.cerand48.cerand48_r.cgcvt.cabs.clabs.catoi.catol.cstrtol.cstrtoul.c_stdlib_strto_l.cqsort.cbsearch.cllabs.catoll.cstrtoll.cstrtoull.c_stdlib_strto_ll.catof.cmblen.cstate.2537mbtowc.cstate.2538wctomb.cmbstowcs.cwcstombs.c_stdlib_mb_cur_max.c_stdlib_wcsto_l.c_stdlib_wcsto_ll.cwcstol.cwcstoul.cwcstoll.cwcstoull.cstrtod.cstrtof.cstrtold.c__strtofpmax.cnan_inf_str.2124__fp_range_check.cwcstod.cwcstof.cwcstold.c__wcstofpmax.c__cxa_atexit.c__cxa_finalize.c__exit_handler.cexit.con_exit.cold_atexit.cconfstr.ccs_path.1842daemon.cexecl.cexecle.cexeclp.cexecv.cexecvp.cdefault_pathfpathconf.cgetlogin.cgetopt.cexchangegetopt_datagetpass.cbuf.2703getsubopt.cpathconf.csleep.cswab.csysconf.cualarm.cusershell.c__free_initshell_memoryshellsstringsinitshellsvalidshcurshellusleep.cforward.clibc_pthread_init.caeabi_unwind_cpp_pr1.c__uClibc_main.c__check_one_fdbeen_there_done_that.2795rpc_thread.crpc_thread_multi__libc_tsd_RPC_VARS_memonce.5584interp.cbpabi.clibgcc2.c__read_etc_hosts_r__GI_wcsftime__GI_if_freenameindex__GI_btowc___path_search__GI_execve__GI_fcntl64__GI_gethostbyaddr__GI_sigaddset__GI___ctype_b__GI_memchr__GI__time_tzset_time_mktime_tzi__libc_argc__GI___glibc_strerror_r__open_nameservers__GI_fopen__GI_fopen64__GI_strlcpy__GI_initstate_r__GI_sigaction__GI_statfs__GI___C_ctype_toupper_data__GI_xdrmem_create__GI_time__GI_ftell__GI_strdup__GI_getpagesize__GI_strptime__GI_h_errno__length_question__GI___ctype_toupper__GI_strcasecmp__GI_tolower__GI_strncmp__encode_question__GI___uClibc_fini__encode_header__GI_strncat__psfs_parse_spec__GI_fstatfs__pthread_mutex_lock__GI_wcsspn__GI_svc_register__GI_cfsetospeed__GI_endservent__rpc_thread_svc_cleanup__getdents__GI_snprintf__GI_vsnprintf__GI___res_query__GI_setsid__GI_sigsuspend__bsd_signal__GI_strpbrk__GI_fgetc_getopt_internal__GI_lstat64__GI_setsockopt__stdio_trans2r_o__GI_hsearch_r_net_stayopen__GI_fclose__GI_wcsnrtombs__GI_pipe_uintmaxtostr__exit_function_table__GI_xdr_pmap_DYNAMIC__aeabi_unwind_cpp_pr0__GI_strftime__GI_random_r__add_to_environ__GI_getnetent__GI___longjmp__GI_tfind__GI_statfs64__GI_if_nameindex__GI_globfree64__GI_basename__GI_clnt_sperror__GI_sbrk__GI___uClibc_init__GI_fread_unlocked__GI_wmemchr__GI_getservbyport_r_create_xid__GI_getspent_r__GI_getgrent_r__GI_strsignal__exit_handler__GI_globfree__GI_fgetgrent_r__GI_lseek64__GI_xdrrec_skiprecord__GI_setrpcent__GI___rpc_thread_svc_fdset__GI_lstat__GI_wcscasecmp__GI_iswcntrl__GI_ttyname_r__GI_xdr_callmsg__GI_iswprint__GI_getpriority__GI_sigpause__GI_svc_getreq__re_error_msgid_idx__GI_getspnam_r__GI___ns_name_unpack__GI_fputs_unlocked__GI_ether_ntoa_r__GI_ctime__parsespent__GI_fgets__glob_is_literal_ppfs_init__GI_memcmp__GI_wcstof__GI___C_ctype_toupper__GI_fgetc_unlocked__GI_fgets_unlocked__pthread_mutex_init__GI_qsort__GI__seterr_reply__GI_setmntent__GI_xdr_string__open_etc_hosts__GI_vswscanf__GI_xprt_register__encode_packet__GI_mknod__GI___fsetlocking__GI_setgroups__GI_wcscat__GI_wcspbrk__GI_closelog__GI_pmap_unset__GI_atol__dns_lookup__GI_read__GI_getlogin__GI_rexec_af__GI_setregid__libc_pthread_functions__GI_remove__GI_readdir__new_exitfn_cs_close__GI_svcudp_bufcreate__GI_fgetspent_r__GI_getnameinfo__GI_vswprintf__GI_iswspace__GI_getprotobyname_r__GI_dup2__GI_fscanf__GI_wcrtomb__GI___libc_fcntl_stdlib_wcsto_ll__GI_memset__GI_closedir__GI_accept__GI_wcstoull__GI___ns_name_uncompress__GI_getpwuid_r__GI_sigwait__aeabi_unwind_cpp_pr2__GI___res_init__GI_strcoll__GI_wcswidth__GI_write__GI_iswpunct__GI_opendir__GI_ungetwc__GI_getrpcent__GI_getmntent_r__GI_xdr_accepted_reply__GI_strtold_string_syserrmsgs__GI_xdrrec_eof__GI_herror__GI_fputws_unlocked__GI_open__GI_strchr__searchdomain__GI_wcslen__GI_wcstoll__GI_open_memstream__GI_inet_makeaddr_time_tzinfo__GI_xdr_rejected_reply__GI_clnt_perror__GI_fstatfs64__GI_tcgetattr__GI_clntudp_create__GI_localtime__GI_inet_ntoa__GI_clnt_spcreateerror__GI_sigwaitinfo__sigjmp_save__libc_drand48_data__GI_fcntl__GI_vfscanf__GI_wcsrtombs__GI_fwrite_unlocked__GI_gethostbyaddr_r__GI_getgid__GI_fputs__GI_chmod__GI_ftruncate64__GI_vscanf__GI_setrlimit__GI_setttyent__GI_inet_ntoa_r__GI_setstate_r__GI_setresgid_svcauth_unix__GI_if_nametoindex__GI_stpcpy__GI_mempcpy__GI_getservbyport__GI___C_ctype_b_data__GI_getttyent_string_syssigmsgs__GI_xdr_replymsg__GI_lrand48_r__GI_xdr_authunix_parms__GI_hcreate_r__GI_fchdir__GI_send__GI_execle__GI_svcerr_auth__GI_syslog__GI_getprotoent_r__GI_exit__app_fini__GI_xdr_pmaplist__GI_xdr_long__exit_cleanup_memcpy__GI___rpc_thread_createerr__GI_asctime_r__GI_execl__GI_asprintf__GI_srandom_r__GI___ctype_tolower__GI_iswgraph__re_search__GI_ftello64__rpc_thread_variables__GI_close__error_at_line__GI_getservent_r__pthread_mutex_trylock__GI_xdrrec_endofrecord__GI_endprotoent__GI_svcerr_decode__GI_brk__GI_strcat_svcauth_short__GI_nanosleep__GI_stat__GI_clnttcp_create__GI_sigprocmask__regexec__GI_wcstoul__GI_gethostname__GI_fseek__re_match_2_custom_printf_arginfo__GI_clntudp_bufcreate__GI_setreuid__GI_vfwprintf__GI___libc_open64__GI_setprotoent_stdlib_strto_ll__GI_strsep__GI_iswlower__GI_strerror__GI_cfsetispeed__raise__GI_vwarnx__GI_ruserpass__GI_getgrgid_r__GI_times__GI_verr__GI_kill__GI_strcmp__libc_sa_len__GI_utimes__glob_match_in_dir__GI_setpgid__scan_ungetc__GI_ioperm__GI_memmove__decode_dotted__scan_getc__stdio_READ__GI_vasprintf__GI_toupper__GI_recv__GI_clnt_sperrno__GI_lfind__GI_isatty__GI_readdir_r_custom_printf_spec__GI_localtime_r__GI_stat64__GI_freeaddrinfo__GI_iswalpha__GI_xdr_opaque_auth__GI_towlower__GI_ioctl__GI_strtof__close_nameservers__GI_getenv__GI_mbsrtowcs__re_compile_pattern__GI_vdprintf__GI_xdr_int__xstat64_conv__decode_header__GI___h_errno_location__GI_memcpy__GI_strtoul__GI__stdlib_mb_cur_max__GI_xdr_callhdr__GI_chown__GI_getprotobynumber_r__GI_rtime__GI_sigdelset__GI_svcerr_noprog__time_localtime_tzi__GI_wcsncasecmp__GI_getservbyname_r__gen_tempname__GI_wcstod__GI_wctype__GI_ftruncate__exit_count__GI_open64__GI___C_ctype_b__GI_tcsetattr__GI_wcstold__glob_freelist__GI___ns_name_ntop__GI___assert__GI_tsearch__GI_gethostbyname_r__opensock__GI_memmem__GI_strncpyahostbuf__GI_adjtimex__GI_lockf__GI___xpg_strerror_r__GI_fgetwc_unlocked__GI_mbsinit__GI___C_ctype_tolower__GI_recvfrom__GI_getrlimit__GI_xdrrec_create__GI_authunix_create_default__GI_strcpy__GI_inet_ntop__GI___fputc_unlocked__decode_question__GI___sigpause__stdio_adjust_position__GI_poll__GI_nrand48_r__GI_seed48_r__GI_truncate__GI_endnetent__re_compile_fastmap__GI_wcscpy__decode_packet__stdio_rfill__GI_bindresvport__GI_fgetwc__GI_sleep__GI_gethostbyname__GI_svc_sendreply__GI_getc_unlocked__GI___libc_fcntl64__sigwait__GI_wcschrnul__GI_rmdir__GI_munmap_store_inttype__length_dotted__GI_fileno__GI_random__GI_mremap__syscall_error__GI_jrand48_r__uclibc_progname__GI_getegid__GI_strtoull__GI_wait4__GI_wmemcpy__rtld_fini__GI_strndup__GI_svcerr_progvers__GI_fork__GI_wcscoll__GI_getpid__GI_getrpcbynumber__GI_fgetws_unlocked__re_set_registers__GI_getsid__GI_fputwc_unlocked__regerror__GI_wordfree__GI_strchrnul__encode_answer__GI_wcstol__GI_socket__GI_iswalnum__GI___libc_lseek__GI_sigfillset__rpc_thread_clnt_cleanup__pgsreader__GI_fputc__GI_xdr_union__GI___C_ctype_tolower_data__stdio_fwrite__GI_sigblock__GI_wcschr__GI_uname__GI_wcsnlen__GI_getrpcbyname__GI_xdr_rmtcallres__init_scan_cookie__GI_setservent__GI_fileno_unlocked__syscall_rt_sigaction__GI_endttyent__xstat_conv__GI_sgetspent_r__GI_vsscanf__GI_abort__parsepwent__GI_endrpcent__GI_unsetenv__GI_xdr_u_short__GI_fprintf__get_hosts_byname_r_cs_seek__glob_append__stdio_init_mutex__GI__exit__GI_getdomainname_time_mktime__GI_iswdigit__GI_fputws__GI_strrchr__GI_asctime__GI___cxa_atexit__wcslcpy__nameserver__GI_sysconf__GI_rewind__GI_getgrnam_r__parsegrent__GI_in6addr_loopback__GI_putc_unlocked__GI___rpc_thread_svc_pollfd__GI___res_querydomain__GI_inet_pton_stdio_fopen__GI_xdr_u_hyper__GI_xdr_opaque__GI_chdir__GI_mbrtowc__vfork__GI_wctrans__GI_lockf64__GI_endmntent__GI_mmap__GI_iswxdigit__GI_xdr_array__GI_fgetpwent_r__GI_mallinfo__GI_strxfrm__GI_iswblank__GI_ffs__GI_select__GI_wcscmp__GI_sigtimedwait__libc_multiple_threads__GI_xdr_bool__GI_getutid__GI_waitpid__GI_getgroups__GI_xdr_u_int__GI_xdr_enum_stdio_term__GI_vfprintf__GI_signal__decode_answer_cs_read__GI_readdir64__GI_vwarn__glob_ignore_err__GI_settimeofday__GI_strtod__GI_setnetent_ppfs_setargs__GI_sendto__GI_mbrlen__GI_xdr_reference__GI_authunix_create__GI_sigemptyset__GI_printf__GI_stpncpy__glob_sort__GI_utime__GI_hdestroy_r__re_match__GI_mbsnrtowcs__GI_tzset_wstdio_fwrite__GI_setresuid__GI_xprt_unregister__GI_setitimer__GI_pmap_set__GI_getchar_unlocked__GI_setutent__GI_sscanf__GI_iswupper__GI_fseeko64__time_tm__GI_getdelim__stdio_wcommit__exit_slots__GI_alarm__GI_getpwent_r__GI_rresvport__GI___fgetc_unlocked__GI_xdr_rmtcall_args__GI_unlink__nameservers__GI_getdtablesize__re_search_2__GI_execvp__GI_gethostent_r__GI_recvmsg__GI_nl_langinfo__drand48_iterate__GI_memrchr__GI_fflush_unlocked__re_set_syntax_GLOBAL_OFFSET_TABLE___GI_xdr_u_long__GI_strstr__searchdomains__GI_fstat__GI_inet_network__GI_listen__regcomp__GI_tdestroy_sigintr_ppfs_prepargs__GI_glob64__GI_strspn_cs_write__GI_svc_getreq_common__GI_strncasecmp__GI_connect__curbrk__GI_readlink_fpmaxtostr__GI_pmap_getport__GI_clntunix_create_stdlib_strto_l__GI___libc_open_stdio_init__stdio_WRITE__GI_sigsetmask__GI_geteuid__regfree__GI_sendmsg__GI_vfwscanf__fp_range_check__GI_fread__re_error_msgid__GI_getcwd__GI_towctrans__GI_perror__GI_gettimeofday__GI_putc__GI_svcudp_create__GI_inet_aton__GI_getaddrinfo__GI_getline_custom_printf_handler__GI_tcgetpgrp__GI_svc_getreq_poll__GI_bind__GI_xdr_void__get_hosts_byaddr_r__GI_lseek__GI_strtoll__getdents64__GI_ungetc__libc_argv__GI_setpriority__GI___cmsg_nxthdr__aeabi_unwind_cpp_pr1__strtofpmax__malloc_consolidate_ppfs_parsespec__GI_strtol__GI_getuid__GI_strtok_r_stdlib_wcsto_l__GI_verrx__GI_setenv__GI_errno__GI_dirfd__GI_openlog__GI_inet_netof__stdio_trans2w_o__GI_vfork__GI_ptsname_r__GI__authenticate__GI_rawmemchr__GI_localeconv__GI_gethostbyname2_r__GI_srand48_r__GI_raise__GI_inet_addr__GI_svc_unregister__GI_seteuid__encode_dotted__GI_fopencookie__GI_strnlen_time_t2tm__GI_towupper__GI___errno_location__GI_xdr_hyper__wcstofpmax__GI_xdr_bytes__GI_readdir64_r__GI__rpc_dtablesize__GI_fdopen__GI_vsyslog__GI_atoi__GI_sprintf__GI_fwrite__GI_getpwnam_r__GI_svc_getreqset__GI_fflush__GI_iswctype__GI_getsockname__GI___rpc_thread_svc_max_pollfd__psfs_do_numeric__GI_wmempcpy__GI_setvbuf__GI_strlen__GI_erand48_r__GI_fstat64__GI_glob__GI_ether_aton_r__GI_fnmatch_load_inttype__GI_mkdir__GI_strcspn__GI_authnone_create__GI_xdr_shortgetwcharseed48_rlongjmp__libc_tcdrainstpcpyputchartsearchclock_gettimein6addr_anyntp_gettimesetgrent__libc_sigaction__aeabi_dcmple__libc_preadwcstoimaxputwmbrlenstrcpychrootasctime__gnu_uldivmod_helperrcmdsetrlimit64inbunsetenv__cmpdf2authunix_createmkstemp64gethostent_rxdr_longlong_twarnxbcmpsetjmpwaitpid__longjmptmpfile__eqdf2xdrrec_create__libc_fsyncxprt_register__divdi3getrlimitclnt_broadcastpauseioctlpthread_cond_signalwritevget_kernel_symssiginterruptscandir64_stdio_openlist_use_countvscanfputspentif_indextonamegetserventstrtok_r__floatdidfmunlockallgetutidposix_fadvise64wcstokgetgidpopensysconfprintfstdoutvsprintfrandomgetspnam_rutimesvcudp_enablecachewcstofdaylightlrand48_r__fsetlockinggetdtablesize_obstack_memory_usedcfgetospeedvswprintfsethostentsetservent__ivalidusergetloginputc_unlockedpthread_attr_destroyrecv__dn_expandllistxattrconnectlockf64ungetcsvcerr_authtcgetsidgetservbyname_r__pthread_once_time_tzlockgetutlinesigemptyset__fbufsizeutimesepoll_wait__sigdelsetshmctlputwchar_unlockedstrerrorfpathconfsvc_exit__uClibc_finimemrchrstrndupgeteuidlsetxattrinet_ptonpthread_attr_initstat64__xpg_basenamesigpausememmovefgetxattrhsearchpthread_exitpclosegetopt_long__fpendingsigholdendnetentsnprintfsyscallpathconf__exidx_endpmap_setmunmapfileno_unlockedulckpwdfsched_getparamgetttyent_longjmpwcstoullrexecoptionsmknodxdr_uint8_tftello64xdrmem_create__gtdf2__libc_fcntlatol_h_errnoxdr_des_blockxdr_opaque_authmalloc_statsruserpassgetc_unlockedgetgrgidclnt_spcreateerrortimesstatfs64re_syntax_optionsftw64nrand48__ctype_bstrtoimaxgetprotobynumberauthunix_create_defaultclnt_perrnoalphasort64getenvwcsleniswcntrl__cyg_profile_func_exitpwrite64fchmod_bss_end__putgrentiswpuncterrnosetfsuidstrtoldgetegidisblanksetlinebufsetprioritylabswcstollgetpriorityiswalphagetspersonality__aeabi_cdcmple__libc_acceptiswblankmemmem_dl_app_init_arraygetresuidbsearchsigrelse__libc_posix_fadvise64usleepwmempcpyexecvegetprotobyname__libc_current_sigrtmaxvsscanfsemgetpthread_condattr_init__libc_pwrite64xdr_int16_tgetpidgetpagesizeerand48_rlremovexattrxdr_u_hyperhsearch_rqsortwcsrchrfchowntruncatesetstate_rfscanffgetsdirname__libc_getpidvwprintfgetnetentiswxdigit__libc_pselect__xpg_strerror_rerror_at_line_pthread_cleanup_popfgetspenthcreatefcntl64getpwgetrlimit64removexattrgetcfgetws_unlockedprctlfchdirmsgrcvshmatre_search_2memcpysetitimerwcswcs__aeabi_cdrcmplepmap_getportsetvbufexeclseekdirsched_rr_get_interval__floatsidfglobsvc_sendreplyperror_rpc_dtablesize__ltdf2swabcreatreadlink_stdio_openlist_dec_use__libc_selectpthread_equal__fwritableputs__cxa_finalizeclock_settime__libc_nanosleeperrxdup2__libc_current_sigrtminislowerustatmbrtowctcflushexecle__fpurgegetpasstolowergetuidtcsendbreakrewinddiriswlowersemctldrand48_rsystemfeoffgetwshasmntopt__rpc_thread_svc_max_pollfdwcspbrkwcstol_obstack_begin_1svcraw_create__res_querydomainmallocremove__udivsi3isattycfgetispeed__aeabi_memsetconfstriswspaceendpwentsiglongjmppthread_attr_getscopesvctcp_create__aeabi_memmove8sleepoptargsched_setschedulerbtowcsysinfostrtollvsnprintf__fixunsdfsiopen_memstreamrecvfrom__aeabi_memcpyxdr_bytessvcerr_decodetcdrain__C_ctype_tolowerstrtoumaxstatfsxdr_int64_twcsncmppivot_root__res_search__bss_start__xdrrec_endofrecordrandom_r__libc_longjmpstrtoul__dso_handle__aeabi_ui2dgetutentsched_getschedulergetprotoent_rwcsstrclock_getreswscanfreaddir_rmktempispunct__libc_pthread_initgethostbyaddrsettimeofdaygethostbyname_r__aeabi_drsub__aeabi_errno_addrwctomb_obstack_newchunkwcstoqopterrclnt_createsigaltstackrmdiradjtimewcstombssgetspent_rsocketselectinit_module_pthread_cleanup_pop_restorereaddirgetgrgid_r__flbffstatfslchownwcpncpyre_matchsetgroupspmap_rmtcalldelete_modulefopencookieclnt_perrorclearerr_unlocked__ns_name_unpackruserokerror_message_countisspacepthread_attr_getinheritschedvwscanf__aeabi_dcmplt__aeabi_memmovehcreate_rinotify_initfgetspent_rmempcpyfflushxdr_voidcreat64__ctype_toupper__libc_pwrite__extendsfdf2__libc_read__aeabi_ddivftruncatexdr_pmapsvcerr_progvers__adddf3fgetgrentrealpathsvcerr_noprocgetwc_unlockedputwc_unlockedgetrpcbynamembstowcs__exidx_startputenvgetservent_r__aeabi_dmul__aeabi_memcpy4lseekwmemcpysigaddsetclearenv__environchownmmapvswscanfstrncasecmpxdr_vectorobstack_exit_failuresvc_getreq_commonwcsnrtombsxdr_rmtcall_argsrexec_afbzero__freadablesetpgid__aeabi_assert__udivdi3sendgetdomainnamesvc_getreqfreeaddrinfosvcunixfd_createsetbuffer__fgetc_unlocked__libc_creat64abortgetptendprotoent__floatunsidfnrand48_rxprt_unregisterpthread_attr_getschedpolicygetservbyport_repoll_ctlwcscollfgetwc_unlockedtznamenftw64gmtime_rseed48chmodgetnameinfo__libc_tsd_RPC_VARS_dataftrylockfilesrandom_risxdigitfstat64tdeletexdr_charalarmclnt_pcreateerror__freadingmlockacct__libc_posix_fadvisestrtoqstrtol__sigsetjmppipe__libc_lseek64fsetposxdr_rmtcallresgetpgrpstrnlenwcstodrawmemchrgetnetbyaddrxdr_doublemblen__aeabi_d2fcapgetunameiswprint__dl_ldso__accept__libc_allocate_rtsigverrx__malloc_statea64lpthread_getschedparamcfsetispeedxdr_int32_tutmpname__libc_pread64inwhdestroy_rrename__sigaddsetxdr_callmsgpthread_setcancelstatexdr_unionsetttyent__sysv_signalstrrchrmbsnrtowcsbasenamewaitidnanosleepwcscpyxdr_enum_obstack_beginh_errnocalloccuseridxdr_boolre_set_registers__pthread_mutex_unlockimaxabstdestroywait4setrlimitinet_lnaofstrtodxdr_wrapstringxdr_rejected_replyrindexinet_makeaddrgai_strerror__aeabi_memclr8setprotoentstatvfs64sendfilelckpwdfpthread_condattr_destroypthread_attr_setscopewriteinet_netofwmemchriopermulimitatofenvironxdr_freesysctlxdr_netobjfstatfdatasyncfprintfjrand48_r__resolv_lock__aeabi_daddkillfputs_unlockediswgraphsetpwent__ledf2ctimeffsdl_iterate_phdr__aeabi_memcpy8xdr_int8_tsvc_registerxdr_longstrcatre_compile_patternputwcbindfgetpos64getspent_r__aeabi_localeconvrand_rgetmntent_r__aeabi_ul2dgetprotoentsvcerr_systemerr_stdio_openlistif_nameindexinet_addrreadvntohltruncate64vprintfreadaheadumount2mkfifogetprotobyname_rpthread_cond_broadcastif_nametoindexmadvisereboot__aeabi_idivchdirswprintfsigwaitinfopthread_attr_setinheritschedinitgroupspmap_unset_stdlib_mb_cur_maxfseeko_stdio_openlist_del_countsetregidlistxattrposix_fadvisesigignoreshmdtfstatvfssetsockoptendgrentbsd_signalxdr_shortfseekmremappthread_setschedparamctermidwait3tmpnam_rsvc_getreqsetnl_langinfoshmgetgetdelimsetstatecfsetospeed__aeabi_dcmpgtmemccpyuseliboptindwcstoldmemchr__pthread_initialize_minimalsvc_getreq_poll__bss_end__swapoff__stdinstdintfindwaitmincorere_match_2__aeabi_dcmpgexdr_accepted_reply__libc_open64scandirumasklfindgethostbyname2_rdprintffremovexattrsvcerr_weakauthxdr_authunix_parmssvcfd_create__aeabi_dsubmktime_resfgetpwent_r__prognametimezonestrcasestrlstatferrorstrstrunlockptgetwchar_unlockedxdr_u_longlong_trtime__floatundidfrandxdr_uint64_tftelloflocksetgidsignalpsignalreadinotify_rm_watchdirfdendutentsetspent__pthread_exitgetspnamget_current_dir_nameopenlog__libc_readvpread64xdr_u_charsendmsgin6addr_loopbackstrlcpyiswctypestrcollclntudp_createcloselogisuppernftwstrncmpquery_modulel64asigorsetwcsrtombs_stdio_user_lockingalphasortgetusershellsethostname__cmsg_nxthdrinlwmemsetsetpgrpwordexpstrncpyunlinksetenvsyncgetrusagefreopen64__aeabi_memclrstrcasecmphtonlsendtoxdr_u_long__C_ctype_touppersched_get_priority_maxfunlockfilewcwidthisasciixdr_replymsgreallocaddmntenton_exit__libc_siglongjmpfclosealltowuppergetrpcentold_atexit__cxa_atexit__libc_sendtmpfile64__aeabi_i2d__aeabi_memmove4readdir64epoll_createpthread_cond_initbcopywcsnlenremquestrtoktowctrans__aeabi_memset8sigfillsetxdr_uint16_t__aeabi_memset4memcmplistensvcerr_noprogsched_get_priority_minsvcudp_bufcreatexdr_opaquewordfreemalloc_trimfdopenforksigsetsscanfexecvsetmntentstatvfsisalphagetgrentlstat64wcscspn__divdf3wcstoulstrncatsetresuidexeclpfputws_unlocked__libc_pausemsgsndsigactionclntunix_createwcschr__uClibc_initxdr_callhdr__muldf3__ns_name_uncompresssetdomainnamere_compendmntentsrand48__res_initgetrpcportkillpg__getpagesizefreadgetprotobynumber_rualarmttyname_routbinet_network__uClibc_main__malloc_lockfwscanfsbrkgetlogin_rstrdup__libc_closeinet_atonether_ntoa_riopl_obstack_allocated_pstrtoullendhostentindexregcomp_pthread_cleanup_push_defermrand48_r__sigismembersymlinkgettimeofdayfopen__bss_startasctime_rwcsncatgetoptsetreuid__libc_openlocaltimeputwcharmemset__cyg_profile_func_enterwcstoumaxfnmatcherr__glibc_strerror_rcfmakerawftwsiggetmasklockf__div0wcsspngetsidftellsrandsethostid__rpc_thread_svc_pollfdstrxfrmvfwprintfstrlcatmbsrtowcs__aeabi_uidivwctypeclearerrlgetxattrgetgrnam_rinitstatemalloptfclosegrantptopen64__truncdfsf2getcharxdr_stringntohsinet_ntoafgetpwentgetppidtcgetattrgethostbyaddr_r__libc_writevgetservbyportptrace__C_ctype_tolower_dataregexecendusershell__libc_recvfromtimeopendirgetgroups__aeabi_l2dxdrstdio_create__libc_systemisgraphwcsncpymsgctlpollbdflushsigtimedwaitgetrpcbynumberftokfgetpossyslogisalnumptsnamewcschrnulhdestroygetitimer__end____form_querytmpnamfwprintfisprintseteuidmrand48xdr_u_intxdrrec_skiprecordputc__divsi3getopt_long_onlyendttyentxdr_pmaplistpthread_attr_getdetachstategetpwent_rmountendrpcentnicefgetgrent_rrresvportgetpwuid_rherror__libc_recvmsgfread_unlockedstrcmp__check_rhosts_fileshutdownfsetpos64pthread_mutex_unlockcallrpc__default_sa_restorer_seterr_reply__rpc_thread_svc_fdsetpmap_getmapslrand48obstack_alloc_failed_handlerttynameregister_printf_functiongetpwuid__h_errno_locationdupswapon__gnu_Unwind_Find_exidxsigblocksigqueuegetcwd__C_ctype_b_data__nedf2gethostbynamestrsignalgetpwnamendspentauthnone_createisctypegetservbynamefgetcgethostnamememalignsprintfvwarn__clz_tabether_aton_r__default_rt_sa_restorerclnttcp_createasprintf_obstackmsyncdifftimestrtofinsqueatexit__libc_waitpidpselecttoasciistrcspn__rpc_thread_destroyflockfilesetlocalegetpeernamegetsuboptiswdigitcfsetspeedscanfregerrorstderrctime_rumountpututlinemmap64mkstempgetttynamerrorerand48fstatvfs64vforksetrpcent__C_ctype_bsetlogmasksched_getaffinitysrandomobstack_freereaddir64_rstrsepsetxattrfstatfs64__libc_forkgetpwnam_rre_compile_fastmapxdr_referenceverrgetgrent_rputchar_unlockedsched_setparamldivregisterrpcsigismembertimelocal__atexit_lockgetwcfsyncvallocinotify_add_watchfputciruserok__libc_lseekgetspentfeof_unlockedxdrrec_eoftimegmmallinfoclnt_sperroroptoptgetchar_unlockedsched_setaffinity__libc_fcntl64_pthread_cleanup_pushpreadpthread_selfpthread_setcanceltypefwideiswuppergetsockopt__aeabi_d2uizglobfreehstrerrorlocaltime_rgetaddrinfore_set_syntaxsocketpairsetresgid__libc_waitfflush_unlockedoutwtwalkstrftimelocaleconvfputwsfwrite_unlockedwmemcmpftime_dl_app_fini_arraylldivinet_ntoa_rstatwmemmove__pagesizesendfile64_stdio_openlist_add_lock__aeabi_uidivmodisdigit__aeabi_dcmpeqmkdtempstpncpygetmntentfwritequotactldysizeoutlaccesssetfsgid_edata__stdout_endbindresvportether_atonhtonspthread_mutex_destroysvc_fdsetlsearchwcscasecmpvfscanfstrptime__rpc_thread_createerrrewindstrtouqfreopenre_searchfgetc_unlockedpthread_mutex_lockinitstate_rdrand48tcgetpgrpif_freenameindexsigandsetungetwc__libc_pollxdr_floatpthread_cond_wait_flushlbf__aeabi_memclr4gethostentgetnetbynamewcsftimesvc_unregister__errno_locationlinkwcsdup_obstack_freesemopexittowlowerether_ntoallabsstimeflistxattrklogctlsigdelsetsetbufsysv_signalinet_ntopbrkiswalnumpthread_mutex_trylockget_myaddressswscanfgetresgid_null_authgetgrnamwcscmpxdr_pointergethostbyname2__C_ctype_toupper_data__libc_sendmsg_errno_authenticateerror_one_per_linegcvtntp_adjtimeatoiglobfree64iscntrl_stdio_openlist_del_lockferror_unlockedpthread_cond_destroyfilenovsyslogpthread_attr_setschedpolicyrexec_setjmpfgets_unlockedgetlineendserventwcpcpy_exitsvcunix_createwcscatgetpwentgmtimestrspnwctobmunlock__libc_recvtempnamdaemonvwarnxpthread_mutex_init__libc_creatstrlenlseek64sigpendingopenvhangupxdr_uint32_tclonexdr_arraytoupper__aeabi_cdcmpeqwprintf__libc_write__gedf2fsetxattratollclockgetw__ns_name_ntopwcsxfrmvdprintf__assertptsname_r__gnu_ldivmod_helperregfree__libc_sendtodivupdwtmpabsstrchrsetutentwcswidth__aeabi_f2dfputssvc_max_pollfdadjtimexexecvp__data_startpthread_attr_setschedparamwcsncasecmpsetsidputpwentsetegidmprotectcapsetrpc_createerr__sigpauseclosedir__libc_msyncwarnsetnetentfgetwcvfwscanfimaxdivcreate_modulewcstouqsetusershell__subdf3vasprintfgetxattrsvcudp_createpthread_attr_setdetachstaterecvmsgfputc_unlockedstrchrnulsvc_runsvc_pollfd__fwriting__libc_sigsuspendfcntltzsetsched_yieldfputwc_unlockedsetuidgetpgid__aeabi_idivmodjrand48__aeabi_ldivmodgethostidfseeko64pthread_cond_timedwaitre_execclntudp_bufcreatetcsetattr__aeabi_atexit__res_querysigisemptysetmkdirposix_memalignsigsetmask__ctype_tolowermsggetclntraw_createsgetspentsigwaitwcrtombpwritecloseparse_printf_formatmlockall__libc_connectpthread_attr_getschedparamglob64__aeabi_MB_CUR_MAXmbtowcsrand48_rtelldirfmemopenvfprintfstrpbrktcsetpgrpxdr_intxdr_hypersigsuspendfputwcraisetcflowclnt_sperrnofreexdr_u_shortsigprocmask__fputc_unlockedgetsocknamembsinitfopen64wctransftruncate64070701002EC7EE0000A1FF00000000000000000000000147CEFADA00000013000000080000001100000000000000000000001300000000lib/libresolv.so.0libresolv-0.9.29.so070701002EC7A6000041ED00000000000000000000000247CEFADA00000000000000080000001100000000000000000000000400000000mnt070701002EC7A70000A1FF00000000000000000000000147CEFADA0000000B000000080000001100000000000000000000000900000000mnt/card/media/card070701002EC7A80000A1FF00000000000000000000000147CEFADA0000000A000000080000001100000000000000000000000800000000mnt/net/media/net070701002EC7A90000A1FF00000000000000000000000147CEFADA0000000A000000080000001100000000000000000000000800000000mnt/ram/media/ram070701002EC7AA0000A1FF00000000000000000000000147CEFADA00000009000000080000001100000000000000000000000700000000mnt/cf/media/cf070701002EC77C000041ED00000000000000000000000947CEEB9F00000000000000080000001100000000000000000000000400000000usr070701002EC7AB000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000800000000usr/bin070701002ECDA70000A1FF00000000000000000000000147CEFAFB00000011000000080000001100000000000000000000000F00000000usr/bin/telnet../../bin/busybox070701002EC9AC0000A1FF00000000000000000000000147CEFAE300000011000000080000001100000000000000000000001200000000usr/bin/deallocvt../../bin/busybox070701002ECDD00000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000000D00000000usr/bin/uniq../../bin/busybox070701002ECDF70000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000000E00000000usr/bin/xargs../../bin/busybox070701002EC88A000081ED00000000000000000000000147CEEAF100002CEC000000080000001100000000000000000000001600000000usr/bin/last.sysvinitELF(T4T)4 (444&&&&&tB&&&Qtd/lib/ld-uClibc.so.0_:86%+  50 74,/*"1!9.2' &-#(3$) h(stL8(0|Ц1p(Hi ;CdJL Qx(p(nЦȊ`XԊldPlXr0z0 |(Hi(QTP 4H@L4Xd,p0| p($ċЋ8Hi܋4 (p((Hi"$3 8 =$D0`K`(X<,]Hmemcpyabortlibc.so.0strcpystrerrorsnprintf__ctype_bsetvbufperrormallocoptarggetnameinfostrrchrfstatfprintfkillctimefseekooptindmktimeftellosignalstrncmpstrncpymemcmpsscanfstrncatfread__uClibc_mainfopengetoptmemsetfclosestrcmpsprintfstderrfputc__stdout__errno_locationexitatoifilenostrlen__data_startfree__fputc_unlocked__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__p(x( |((-(0'''''' ' ' '''''''''((( ((( (!(" (#$($((&,('0((4()8(+<(,@(.D(2H(3L(4P(5T(6X(8\(9 -L-LƏ ʌLƏ ʌDƏ ʌ<Ə ʌ4Ə ʌ,Ə ʌ$Ə ʌƏ ʌƏ ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ|Ə ʌtƏ ʌlƏ ʌdƏ ʌ\Ə ʌTƏ ʌLƏ ʌDƏ ʌ<Ə ʌ4Ə ʌ,Ə ʌ$Ə ʌƏ ʌƏ ʌ   --- 0뜣tDGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/(-(M0 S R/Ѝ/&-0 M m(-Mk00Ѝ@i-M9Ѝgt-M,E-lMH@D0  PP% P-pP>Q@ wP @0P@g@ PPp 0P 0 chHɀ^ BxHaPt -Uo(0)8i8)4)`(@(  x0Q 8  ,#4$,,<,$,  0Ѝ0@^>ȾTQhRp@-@fPP`,   Q M0MN ^ @ 8#4 $<@$<$Ġ$@03````p@$ȾTQhRA-p*`P7 P MN0 ^  P 8#D %<P%4%Ƞ%L 0 P @   ( AȾTQhRp@-@PP`,    0MN ^ @ 8#4 $<@$<$Ġ$@0````p@ȾTQhR@-@@0P04      llRO-uMN5%@\ 0 0C\0S@2 lRx80-MP % R ЍЍdRXR-p@-MPP@PT @` 440RP@ 0PRxA-ll0@`T\p@eT`  PP40@eT`hRdR\Qȿ0@- R! ^' @0Qώ@(/"/000b0c/"/000b b\` \@DP$04 \n`QhRlRlQpR`RhQ@-HHH@ q@440 (\ BXQXRlQ\RtR@-X@HP0P B<P ,@,4e bWlQdRXRXQ\QO-錃cs0儓M 0p`  X3 Pd?@7Q ddddddddddddddddddddddtdddddddddddddd 8ddtdddddd( @H 4RPp @Qe P f R 1 1PЍ}1 A~ sp~{xMvhrT!C!00m 8A P.\&1  X T@p = ͠i/pF{CzP +)&#jP& x HRQlQPR\RXQ`TQpRhQdQ`R`Q\QHP0@-a @M~T0(PM  ( |"4Ā.\ 1Qp1( p/"/000b0c/ "/00ba\F0!^ $pW!q M>$ (P 8,#4.<   ЍQp x0 @ 0   bX< b<Ѝ@TQlRhRlQ`Q`RdRxRhQpQ@-a @M~T0(PM  ( |"4Ā.\ Q1 p .p./00bc/"/00ba\F0^ $pW!q M>$0 P 8,#4.<   Ѝ Rp x0 @0   bXx< b<Ѝ@odTQlRhRlQ`Q`RdRxRhQpQ@-a @M~T0(PM  ( |"4Ā.\ Q1 p :p./00bc/"/00ba\F0^ $pW!qz M>$0 P 8,#4.<   Ѝ Rp x0 @0   bX< b<Ѝ@TQlRhRlQ`Q`RdRxRhQpQ@-a @M~T0(PM  ( |"4Ā.\ Q1 p :p./00bc/"/00ba\F0^ $pW!qv M>$0 P 8,#4.<   Ѝ Rp |x0 @0   bXp< b<Ѝ@g\TQlRhRlQ`Q`RdRxRhQpQO-MlM@_la ["*`X (P"04", 0ER P04fm !$PR$ @T $_la [:ߍP04 !$ i0 PXă0E ("h`d ",RP P4Ƞ,, . PPP0 4*4 0HP$$ @@ Q0,a,& 0 ` 48V 8#4,$ <00 S V8#4, <$   i 0 u@sV4ʠ .$@R? OR J0Rv   RQl=P  XP=@ĎU(V  8̠#DT l0 i ?,0S PPY `@ TP GM,^ 0 @ĂU8\VpQ 01P` @ 054$-0,00\10H1041201600.000X10D100130\Q`170ČHa0/0(`000ȌDaD0@A0,0@`84AQ̌@XQ0A<Q@ QH,AH AH @H@Ah4`LdA4@Xh$D4@%D\PQ,Q,@L?H^ 8#4,$ <00 S #^8#4, <$   n 0c(f  @ PDn 0@3TcUPP(\tQ ` `00@P` 00 $(008Q@ <)dሑ,,̠(  ⬐\Tᰐ$`l d H$D ("L, ($.!̀(#  P! 0 0 @f_t n1 @Pn   Q 0,!,"! "#`DX^ 8#4,$ <00 S 0^,8#4 <$   n 0B 0SC J (@QP,`,)$%`&'4(^ 8#4,$ <00 S 8P^8#4, <$   n 0@XRTQx`R`Qh0@\RxXRdQhQ0@808(V  8,#4 ,tpPPH @0$U̎Vx< P  `4T(,\@aP 8\<T.D @lLDa &,Ġ # "lP Q ix1@8 PQ 0a &P8@Ú8 #4 , $,< 00Sr bU8 #4 , $,<  0 n<m6 01P` @ 0l54$`-0,T0000|00t020h060\0.0P0000x00p030``Pd070Č|`X0/0(\`L000ȌD0@l@T00@8tPh@PP@lxPp@aX0l\d ĽL 0  @Pd$ 8h̆@U ("804 ",\C J @\0. a.& `ȉU 8#4,$ <00SZ 4U,P8#4 <$   e0 P0P `H`H 0@P`D0004000$ 0(8̃ = 12cleanmarker size must be < eraseblock sizeWrong bitmask at 0x%08x, 0x%04x Wrong hdr_crc at 0x%08x, 0x%08x instead of 0x%08x Obsolete%8s Inode node at 0x%08x, totlen 0x%08x, #ino %5d, version %5d, isize %8d, csize %8d, dsize %8d, offset %8d Wrong node_crc at 0x%08x, 0x%08x instead of 0x%08x Wrong data_crc at 0x%08x, 0x%08x instead of 0x%08x %8s Dirent node at 0x%08x, totlen 0x%08x, #pino %5d, version %5d, #ino %8d, nsize %8d, name %s Wrong name_crc at 0x%08x, 0x%08x instead of 0x%08x %8s Xdatum node at 0x%08x, totlen 0x%08x, #xid %5u, version %5u Wrong node_crc at 0x%08x, 0x%08x instead of 0x%08x Wrong data_crc at 0x%08x, 0x%08x instead of 0x%08x %8s Xref node at 0x%08x, totlen 0x%08x, #ino %5u, xid %5u %8s Cleanmarker at 0x%08x, totlen 0x%08x %8s Padding node at 0x%08x, totlen 0x%08x %8s Unknown node at 0x%08x, totlen 0x%08x You must specify input and output files! Usage: sumtool [OPTIONS] -i inputfile -o outputfile Convert the input JFFS2 image to a summarized JFFS2 image Summary makes mounting faster - if summary support enabled in your kernel Options: -e, --eraseblock=SIZE Use erase block size SIZE (default: 64KiB) (usually 16KiB on NAND) -c, --cleanmarker=SIZE Size of cleanmarker (default 12). (usually 16 bytes on NAND, and will be set to this value if left at the default 12). Will be stored in OOB after each physical page composing a physical eraseblock. -n, --no-cleanmarkers Don't add a cleanmarker to every eraseblock -o, --output=FILE Output to FILE -i, --input=FILE Input from FILE -b, --bigendian Image is big endian -l --littleendian Image is little endian -h, --help Display this help text -v, --verbose Verbose operation -V, --version Display version information -p, --pad Pad the OUTPUT with 0xFF to the end of the final eraseblock $Revision: 1.9 $o:i:e:hvVblnc:poutputinputeraseblockhelpverboseversionbigendianlittleendianno-cleanmarkerscleanmarkerpad80w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-X< t dPP` 3 P P oie(h0v8V@bPl`npcpAaeabi5TE sumtoolꈕK.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  !``3) 2 ;tt6@AĈ5Gdd>Mxx>UN_PPkPPwPP| P PPPpLQLQ@R@RDp@R[R gR070701002EC8DF000081ED00000000000000000000000147CEEB9F000025B0000000080000001100000000000000000000001100000000usr/bin/nanddumpELF(D4"4 (444  8t   Qtd/lib/ld-uClibc.so.0>!    lTx t*#d*/8!8!`6~0=0E 0 P F,  T8[D@c jP  q\$htH abortlibc.so.0strerrorgetgrgidfchmodperrorisattyfstatfprintf__uClibc_mainstrcmpttynamestderrfwrite__errno_locationexitgetgrnam__data_start__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__ d h l p t x |           -L-圅ƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$  --- 0똉GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/ -(M0 S R/Ѝ/ -MP 0 0p03Ѝ訉-MPЍ訉@-@\M`P!0 \Ѝ P P%p T4T 8<0 yQnQW0 P0yQ 0@ _oO yQ00 0R =P0WPllh%I4 P`>p 00-= ȉ؉Љ8 -Lttystdin: is not a tty fstatynis %s Usage: mesg [y|n] mesg: error: tty device is not owned by group `%s' mesg: %s: %s @(#) mesg 2.81 31-Jul-2001 miquels@cistron.nl |  (X X  HAaeabi5TE mesg.sysvinit|Ը.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink P XX!(() 2 ;6AG M2 Uxx _| | k  w  |  X X L    p   070701002EC8A40000A1FF00000000000000000000000147CEFADB0000000E000000080000001100000000000000000000000E00000000usr/bin/vlock/bin/tinylogin070701002ECC500000A1FF00000000000000000000000147CEFAEF00000011000000080000001100000000000000000000000F00000000usr/bin/logger../../bin/busybox070701002EC88C000081ED00000000000000000000000147CEEAF100001DF8000000080000001100000000000000000000001600000000usr/bin/wall.sysvinitELF(4`4 (444Qtd/lib/ld-uClibc.so.0y>' 1.);<6/30 -9,:*&8!25=#($  "4 +%7\(h0!t -050ȗh>0FL0S Zȋ<|eԋnȗ`uP{ 0((htP 4H@LXd4pD|0|$ ČЌ8܌0h@"H+43: @XE$|hL0Q<`HdXT_`hlnp x0{abortlibc.so.0unsetenvgetgidsigemptysetgeteuidsnprintfgetegidfgetsgetuidisattysiglongjmpgetutentfflushalarm__sigsetjmpfprintfctimestrcatoptindstdinstrstrendutentopenlogcloselogstrncmpfdopenforkstrncatsigaction__uClibc_maingetoptmemsetfclosesyslogttynamegetpwuidsprintfstderrfputcstatfwriteexitstrlenstrchrsetutentfputs__data_start__fputc_unlocked__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__/      !"# $$&(',(0)4*8,<-@.D0H1L2P5T6X7\8`9d:h<l= -L-PƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ  --- 04Ԓ8GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/-(M0 S R/Ѝ/4@-@_M T`% ]OaPU U  \ \0V0 0Q#)dPP/ _ߍSQ|#|3 @$PsP X @Qg@P03@ 0 ?P@ `"CU T`r ;Pp *\@P+ ^, R @p 0P!SO N1SPPD@P Sύ#P0S S&! 0@`Z U*"T > @)p@PW P P PP %PP aP`P PP So |`PPPP  0@T pP HQ  ^@45:@Tomqi D_RT@ DepX`PHؖȖ-M=O-AM,MAmA]0F(  P`*zP # r"^p( nP 0 slЍڍP@T 0| `aP`"  DBT0 ST<@0dS(J(bJP@4V(JF(qJ@ Tp< P;0 X3 F\ -     0 N0 P U! P P  0S S S S 0S S 0@0CA-A@B(0S@ @ 0S ST0@@ d 0P@Z SP8HX` -Lrootuid %d/dev/(%.28s)  Remote broadcast message (%s):  Broadcast message from %s %s(%s): /dev/%.*s/../w ^%cYou don't exist. Go away. wall -n: not priviliged usage: wall [message] nwallwall: user %s broadcasted %d lines (%d chars)TZ@(#) wall 2.79 12-Sep-2000 miquels@cistron.nl$ 8 4̇  xHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHAaeabi5TE wall.sysvinity?.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  !̇)  2  x;88 6HH HA G44M2HHUȗ_kw|pp |p|070701002ECC530000A1FF00000000000000000000000147CEFAEF00000011000000080000001100000000000000000000001100000000usr/bin/loadfont../../bin/busybox070701002EC8E0000081ED00000000000000000000000147CEEB9F00001004000000080000001100000000000000000000001300000000usr/bin/flash_lockELF(44l 4 (444t t t t t $  Qtd/lib/ld-uClibc.so.0+    Ttp  fpȄ`Ԅ0 Y4P %4-04  B  { INdS `0(abortraiselibc.so.0ioctlfprintfstrncmpsscanf__uClibc_mainstderrexitopen__data_startclose__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__ \ ` d h  l  p  t x |   -L-嘆ƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌP  --- 0GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/ -(M0 S R/Ѝ/| A-P0MP6@ lP5pP3D P14(  $,  P(`0eV,,@t FT/  `$zP#0Ѝ7@, 0r|   tPeumX \\f L ,@0<Q[XM M@ hȉP  Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/-/@-@A/@-@/ -LUSAGE: %s /dev/mtd'%s' is not a MTD device. Must specify mtd device: /dev/mtd? Could not open mtd device: %s Could not get MTD device info from %s %x%d%x is beyond device size %x %d are too many sectors, device only has %d Could not lock MTD device: %s ȅ t x  P PH@ Aaeabi5TE flash_lock#.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  p!) @@2 HHP;6A44GM2 pUpp _t t kx x w| | |  P P 4    p   070701002ECD500000A1FF00000000000000000000000147CEFAFA00000011000000080000001100000000000000000000000D00000000usr/bin/sort../../bin/busybox070701002ECBC70000A1FF00000000000000000000000147CEFAE800000011000000080000001100000000000000000000000D00000000usr/bin/head../../bin/busybox070701002EC9CE0000A1FF00000000000000000000000147CEFAF600000011000000080000001100000000000000000000001100000000usr/bin/nslookup../../bin/busybox070701002ECCA40000A1FF00000000000000000000000147CEFAEF00000011000000080000001100000000000000000000000F00000000usr/bin/mkfifo../../bin/busybox070701002ECDA10000A1FF00000000000000000000000147CEFAFB00000011000000080000001100000000000000000000000C00000000usr/bin/tee../../bin/busybox070701002ECDAF0000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000001300000000usr/bin/traceroute../../bin/busybox070701002EC8E1000081ED00000000000000000000000147CEEB9F00002A24000000080000001100000000000000000000001200000000usr/bin/nandwriteELF(4&4 (444"""""0 """Qtd/lib/ld-uClibc.so.0:$!#  "    ĆT$%+І  @/܆ 7d>C%% J0 `PW$0_%@/P f00k<%yH@/%T%@/`$lx dH#0memcpyabortraiselibc.so.0ioctlstdoutgetopt_longperrorputsoptarglseekstrtolfprintfoptindread__uClibc_mainmemsetstderrfwrite__errno_locationexitatoiopen__data_startpwriteclose__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__%% %%""### # # ### #$#(#,#0#4#8#<#!@#"D## -L-,Ə ʌ,Ə ʌ$Ə ʌƏ ʌƏ ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ  --- 0 GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/%-(M0 S R/Ѝ/"- M - M0A-t3M`P@ p L3 ptp yP܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈ ܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈܈$܈܈܈<܈܈܈L܈܈\l|܈܈܈܈܈܈̋ 0SIesq(m1g c1_ [0WS0O K C ?P b\P ' h0d ЍS)'(&%%&&&&&&&&&%&&O-KM , @ 0S  Rip  wP0\`U \ @\ X 0  RH^t RhȟP`\ R~@LL(ȟ0Q 1kp  D P ?gG `\R@Q 0 >P M \Kx' aSU \`P@w fpZ ,ǟY  PP Y` `&6@P @P 0S0R Qaml^P 0S3  @Pp 47  PW0SS PP %P  J  M PC 0S X\H5   $%h0* Q' 0S Kߍ0  @qPLPU{dD !0pqq4 j^ MP |R}o(ğ07 c00lCd@00T$@TmD0N N@P`^U`ч  7Uh0S% s , PT\ 0SQ 3 `0#|A/PlD0 0P> ,@pj|pd R03"` p TR 00C F/Pz`V=`$ 00P  R*`P0 e A$0$  lQ`Pn P2l!P/ T r @`΍@P 0t.mP dr\o( Rc @t a @RXP8 Y5VH5 0k,M)J&&&&&M H%%X&&&P#&&'x&& M@$ M@ MȀ$8H%0h&@'M M@&8%8 M@Xhȟ( Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/-Y/@-@A/Q B aB Q' 00`BS&(   QQ11"1:QQ11 1:S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3/Q!! # 3 Q!! "Q!! "Q \3`B/-/@-@A/@-@/ -Lnandwrite $Revision: 1.32 $ Copyright (C) 2003 Thomas Gleixner nandwrite comes with NO WARRANTY to the extent permitted by law. You may redistribute copies of nandwrite under the terms of the GNU General Public Licence. See the file `COPYING' for more information.Usage: nandwrite [OPTION] MTD_DEVICE INPUTFILE Writes to the specified MTD device. -a, --autoplace Use auto oob layout -j, --jffs2 force jffs2 oob layout (legacy support) -y, --yaffs force yaffs oob layout (legacy support) -f, --forcelegacy force legacy support on autoplacement enabled mtd device -m, --markbad mark blocks bad if write fails -n, --noecc write without ecc -o, --oob image contains oob data -s addr, --start=addr set start address (default is 0) -p, --pad pad to page size -b, --blockalign=1|2|4 set multiple of eraseblocks to align to -q, --quiet don't display progress messages --help display this help and exit --version output version information and exitCan't pad when oob data is present. open flashMEMGETINFOUnknown flash (not normal NAND) MEMGETOOBSELMEMSETOOBSELMTDFILEMODEAutoplacement is not possible for legacy -j/-y options Use -f option to enforce legacy placement on autoplacement enabled mtd device YAFSS cannot operate on 256 Byte page sizeopen input fileInput file is not page aligned Image %d bytes, NAND page %d bytes, OOB area %u bytes, device size %u bytes Input file does not fit into deviceWriting data to block %x ioctl(MEMGETBADBLOCK)Bad block at %x, %u block(s) from %x will be skipped File I/O error on input fileioctl(MEMWRITEOOB)pwritelseekFailed to seek backwards to recover from write error Erasing failed write from %08lx-%08lx MEMERASEMarking block at %08lx bad MEMSETBADBLOCKData was only partially written due to error helpversionautoplaceblockalignforcelegacyjffs2markbadnoeccoobpadquietstartyaffsab:fjmnopqs:yabȠfؠjmnopqsyH, ""Ȅ  " " Aaeabi5TE nandwriteLA.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  @!Ȅ)  2 ;6AXG M U "_""k""w""|""""\H#H#d%% p%%%070701002ECBF90000A1FF00000000000000000000000147CEFAEB00000011000000080000001100000000000000000000000B00000000usr/bin/id../../bin/busybox070701002EC9000000A1FF00000000000000000000000147CEFADC00000011000000080000001100000000000000000000001100000000usr/bin/basename../../bin/busybox070701002EC98E0000A1FF00000000000000000000000147CEFAE100000011000000080000001100000000000000000000000C00000000usr/bin/cut../../bin/busybox070701002ECE240000A1FF00000000000000000000000147CEFAFD0000000D000000080000001100000000000000000000000D00000000usr/bin/wallwall.sysvinit070701002ECDA30000A1FF00000000000000000000000147CEFAFB00000011000000080000001100000000000000000000000D00000000usr/bin/test../../bin/busybox070701002EC8E3000081ED00000000000000000000000147CEEB9F000015B8000000080000001100000000000000000000001500000000usr/bin/doc_loadbiosELF(4 4 (444<H   Qtd/lib/ld-uClibc.so.06      TELH$d$0)<L <0H8T0``nl0>xXD0HP L0Q<_Hf@m<Htdy4̆0؆,abortraiselibc.so.0ioctlperrorputsmallocstrtoullseekfstatfprintfread__uClibc_mainmemsetstderrfwriteopen__data_startclosefree__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__@     $(,0 -L-ԊƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌD  --- 0댌GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/D-(M0 S R/Ѝ/O-PMP@0#00C Ѝ`PFPEP5` qPLU?p wPXY4l [:* @Pl40@ R1 H@O< HP ,JY vC ki;7_ 8lpa& -PQX& W 0  t  #X X P= ,W( 0 $  X  4P, P T ,  P@,`*Y  Dth0 X@M M@ 00`hEHP Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/-/@-@A/@-@/ -L tailReading IPL%s area of length %lu at offset %lu readPerforming Flash Erase of length %lu at offset %lu ioctl(MEMERASE)Writing IPL%s area of length %lu at offset %lu writeWriting the firmware of length %lu at %lu... Done.You must specify a device, the source firmware file and the offset Open flash deviceOpen firmware file Stat firmware fileioctl(MEMGETINFO)lseekNot enough memory for IPL tail buffer of %lu bytes h hh PH Aaeabi5TE doc_loadbiosU\.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink ` hh!hh) HH2 PP;6AG M2 U_kw|  X44@<p<Wk070701002EC88D0000A1FF00000000000000000000000147CEFADB00000004000000080000001100000000000000000000000E00000000usr/bin/lastblast070701002EC7770000A1FF00000000000000000000000147CEFAF700000011000000080000001100000000000000000000000B00000000usr/bin/od../../bin/busybox070701002EC9010000A1FF00000000000000000000000147CEFADC00000011000000080000001100000000000000000000000B00000000usr/bin/ar../../bin/busybox070701002EC8E4000081ED00000000000000000000000147CEEB9F000012D0000000080000001100000000000000000000001400000000usr/bin/flash_eraseELF(484 (4444 4 4 4 4 $4@ @ @ Qtd/lib/ld-uClibc.so.0#    $T0LX0h%<d,HX1T0``8l?x,htP FXhT[`bXhidnP{0abortlibc.so.0ioctlprintfstdoutperrorputsfflushstrtolcalloc__uClibc_mainstrcmpstderrfwriteopen__data_startclose__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__X` $(, 0 4 8 <@DHL -L-ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ  --- 0`؉GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/d-(M0 S R/Ѝ/< A-(Mp@ `PP. 0T$0 p&Ā p  @T   $V x zPd tP Tv@s(Ѝ0kM XpM@M@ЋO-M@  0cY`"@P0FY@  P ;pPlP Ѝ@Q !X:@Y`$' PYR`p. ^ TP& `\  P"   P 0,.X:@PPD 4 MHM@pXM@pЋE-PM@PLЍ`8pP  P TP  T`TP P@P 0   ph P \ 0 0ꘌ`M -L Performing Flash Erase of length %u at offset 0x%x Performing Flash unlock at offset 0x%x MTD Unlock failure MTD Erase failure doneRegion %d is at %d of %d sector and with sector size %x Starting offset %x not within chip. Moving to region %d -h--helpUsage: flash_erase MTD-device [start] [cnt (# erase blocks)] [lock] flash_erase -h | --helpFile open error Erase Total %d Units T8 `4 8  h@ Aaeabi5TE flash_erase.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  !) 2 h;6AG`` M2pp U00 _4 4 k8 8 w< < |@ @ @PPXXpXs070701002ECD1E0000A1FF00000000000000000000000147CEFAF700000011000000080000001100000000000000000000000F00000000usr/bin/openvt../../bin/busybox070701002EC9C60000A1FF00000000000000000000000147CEFAE300000011000000080000001100000000000000000000001000000000usr/bin/dirname../../bin/busybox070701002ECDEE0000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000000D00000000usr/bin/wget../../bin/busybox070701002EC97D0000A1FF00000000000000000000000147CEFAE000000011000000080000001100000000000000000000000E00000000usr/bin/clear../../bin/busybox070701002EC9E90000A1FF00000000000000000000000147CEFAE500000011000000080000001100000000000000000000000D00000000usr/bin/expr../../bin/busybox070701002ECBEA0000A1FF00000000000000000000000147CEFAF800000011000000080000001100000000000000000000000F00000000usr/bin/renice../../bin/busybox070701002ECD990000A1FF00000000000000000000000147CEFAFB00000011000000080000001100000000000000000000000D00000000usr/bin/tail../../bin/busybox070701002EC9030000A1FF00000000000000000000000147CEFADC00000011000000080000001100000000000000000000000C00000000usr/bin/awk../../bin/busybox070701002ECAF50000A1FF00000000000000000000000147CEFAE600000011000000080000001100000000000000000000000D00000000usr/bin/free../../bin/busybox070701002EC9900000A1FF00000000000000000000000147CEFAE400000011000000080000001100000000000000000000000C00000000usr/bin/env../../bin/busybox070701002ECE220000A1FF00000000000000000000000147CEFAFD0000000D000000080000001100000000000000000000000D00000000usr/bin/mesgmesg.sysvinit070701002ECDB60000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000000C00000000usr/bin/who../../bin/busybox070701002ECC0C0000A1FF00000000000000000000000147CEFAFB00000011000000080000001100000000000000000000000D00000000usr/bin/time../../bin/busybox070701002ECAD90000A1FF00000000000000000000000147CEFAE600000011000000080000001100000000000000000000000D00000000usr/bin/find../../bin/busybox070701002ECC390000A1FF00000000000000000000000147CEFAED00000011000000080000001100000000000000000000001000000000usr/bin/killall../../bin/busybox070701002EC5E20000A1FF00000000000000000000000147CEFAE400000011000000080000001100000000000000000000000B00000000usr/bin/du../../bin/busybox070701002EC8E5000081ED00000000000000000000000147CEEB9F00002B94000000080000001100000000000000000000001200000000usr/bin/mkfs.jffsELF(4'4 (444%%%%%d%%%Qtd/lib/ld-uClibc.so.0U-&)%* +" (! $,#'  d( '&$'=H'p 0|d70@L G('.'N`V]Ĉ0eЈ(l܈ r,'<H'P yX <$ "'0$<HT HH'`0'zlXx'H'`',memcpyabortlibc.so.0strcpystdout__ctype_bperrorreadlinkmallocoptargreaddirstrtolfprintfstrcatfseekoptindlstatstrncatfread__uClibc_mainstrdupfopengetoptmemsetfcloseopendirstrcmpstderrfwriteexitstrlen__data_startclosedirfree__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__ '$'(' ,'0'#&&&&& & &&&&&&&&&&&&&&& &"&$&%'(')'+ ', -L-4Ə ʌ4Ə ʌ,Ə ʌ$Ə ʌƏ ʌƏ ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ|Ə ʌtƏ ʌlƏ ʌdƏ ʌ\  --- 08 @GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/4'-(M0 S R/Ѝ/%Q 0 R /H0-( ,<"4 ,^^ ^D'4 !4 4R0/R R//D'P00S S S00/<Ġ ,!$0/D'@-<@^ 00m0M h0E @b0'H0@-AMP )0 Q    t h \!P !D 8 , $ ( , 0 1 2? 2,3 2 #3 4 ##0t Ѝ0@0'@hpП0PpР8`ء Hp -1LM`Q(phQ d0(p2@ @+}P@= 00 `@c0 <PP   sP@ @ d0rP @T :z$Kl PpR<` 0DJx 40& op@'0'x`(ТMO-@0M(<0p`8 P `` He l1 R``0 C <0>0 R= P   Q Q"0S8#8 #440 S" S  0 X0 < 0 ЍOЍ/@0 X 0  0`<0Y  0갥@'0'D'<' -Lp@`P0 c!Qa@@ڸ    P/\@D /PP  BR@D^/^ P/P 00P/PPf   $K@'0' -LEM 0 @ 0Sş eP @ i T@P %P Pڔ P PP  Q  Pe hPpp $<@T5 1K7P2ğQd@ 0@ pK lKdKhK `Kp\K@(p"ZK!XK|TKyPKvHKsDKp>[ <K?`>`K>[@ K@0>0K>[?@K=pK>K`6K8Kqn`4 .HKw0C<KL@[4=X8K%Z< 6("SKP =K 0 J TP0SM VK M %LK"P0p =pK: S S(  S S! ):  S SK<K Q x fRHK  HK`HKg@Pf /^PPhHK0@ pHK@0 SP40S : S 4P 0P ;@Pv(K 0.S .\ .Pc@ `P@@ [4/T0/ S ڠ 0 @0B@ d0$ 129`4 4)H%< 4@'0'ȣ @1984'Ȥp8G-MpPPb`OLIF`CUR:741.+ @?0@P@  @P+(<@@@!0XP 0rT0 P J0S 0SEЍ`1984@'E-2܂ Mp`"}pu aAPR꬛Hl@HhP<2   ,`PZ2d@"Q  0S/^/00@  /A)Pq  85@T PUT,P4Q   AW @Qؠ& 0  `' 0`PUڀp0  0 0  ? '('P@D'H8''0'@'$','` -LUsage: mkfs.jffs -d root_directory [-a little|big] [-e erase_size] [-o output_file] [-v[0-9]] By default, the file system is built using the same endianness as the host. If building for a different target, use the -a option. jffs_raw_inode: inode number: %u { 0x%08x, /* magic */ 0x%08x, /* ino */ 0x%08x, /* pino */ 0x%08x, /* version */ 0x%08x, /* mode */ 0x%04x, /* uid */ 0x%04x, /* gid */ 0x%08x, /* atime */ 0x%08x, /* mtime */ 0x%08x, /* ctime */ 0x%08x, /* offset */ 0x%08x, /* dsize */ 0x%08x, /* rsize */ 0x%02x, /* nsize */ 0x%02x, /* nlink */ 0x%02x, /* spare */ %u, /* rename */ %u, /* deleted */ 0x%02x, /* accurate */ 0x%08x, /* dchksum */ 0x%04x, /* nchksum */ 0x%04x, /* chksum */ } ***read_data(): f: 0x%08x, path: "%s", offset: %u file's size: %u read_data(): malloc() failed! (*data) rread_data(): Couldn't open "%s". read_data(): fseek failure: path = %s, offset = %u. read_data(): fread failure (%s). ***write_file() jffs_print_trace(): path: "%s" %s ***mkfs(): path: "%s" opendirmkfs(): opendir() failed! (%s) mkfs(): name: %s mkfs(): filename: %s lstatmkfs(): filename: "%s", ino: %d, parent: %d mkfs(): malloc() failed! (linkdata) mkfs(): readlink() failed! f.name = "%s" mkfs(): new_path: "%s" statverbose level must be between 0 and 9! wunable to open file %s for output. littlebiga:d:e:v::o:h?Error: must specify a root directory Constructing JFFS filesystem... H, @ 8%% P &`8(%PPPPPPPPPPPPPPPPPPPPPPPPPPPPAaeabi5TE mkfs.jffsL).shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  !P) 88(2 ``;@@6PPdA G88MHHlU%_%%k%%w%%|%%&&|''  ''(p'7'G'070701002EC6C0000081ED00000000000000000000000147CEEB9F00000CB4000000080000001100000000000000000000001300000000usr/bin/flash_infoELF(X4 4 (44444444@@@Qtd/lib/ld-uClibc.so.0#    TLZ0Hy<L0(`HEXP 4m<H,@3@f<aH:Ld?4abortlibc.so.0ioctlprintf__uClibc_mainstderrfwriteopen__data_start__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__@  $( ,0 -L-ƏʌƏʌƏʌƏʌƏʌƏʌ  --- 0P(GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/D-(M0 S R/Ѝ/<p@-P M@ 0  ЍpPP0  `P  0S@ ` @@PD @P,  {@`MM -LUsage: flash_info device File open error Device %s has %d erase regions Region %d is at 0x%x with size 0x%x and has 0x%x blocks Strange can not read region %d from a %d region device Є P48 0@Aaeabi5TE flash_infof7.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  0!) 2 0;6\AXXGPPM2``U00_44k88w<<|@@$44@<p<Wg070701002ECC8A0000A1FF00000000000000000000000147CEFAEF00000011000000080000001100000000000000000000001000000000usr/bin/logname../../bin/busybox070701002ECDF20000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000000F00000000usr/bin/whoami../../bin/busybox070701002ECDAD0000A1FF00000000000000000000000147CEFAFB00000011000000080000001100000000000000000000000B00000000usr/bin/tr../../bin/busybox070701002EC91D0000A1FF00000000000000000000000147CEFADC00000011000000080000001100000000000000000000001000000000usr/bin/bunzip2../../bin/busybox070701002ECD010000A1FF00000000000000000000000147CEFAF500000011000000080000001100000000000000000000000B00000000usr/bin/nc../../bin/busybox070701002ECD940000A1FF00000000000000000000000147CEFAFB00000011000000080000001100000000000000000000000C00000000usr/bin/top../../bin/busybox070701002ECDF80000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000000C00000000usr/bin/yes../../bin/busybox070701002ECDA80000A1FF00000000000000000000000147CEFAFB00000011000000080000001100000000000000000000000D00000000usr/bin/tftp../../bin/busybox070701002EC9250000A1FF00000000000000000000000147CEFADD00000011000000080000001100000000000000000000000E00000000usr/bin/bzcat../../bin/busybox070701002EC6D9000081ED00000000000000000000000147CEEB9F000098E4000000080000001100000000000000000000001300000000usr/bin/mkfs.jffs2ELF(4L4 (444ddl  Qtd/lib/ld-uClibc.so.0OABD= E -2.5M/>F:C(H9 67<0,J"*K8;?41$L3)G &'N#+ !%@I ( 4L@p8 G, I` Stwؔ8#D]P+\ ehdlt0u2L z xhl9;` 0`@̍Ȏ$FԎ,0X30S00vؔ(|P 4X@0L4Xdp0|<4` \lfmď8ؔЏ܏tx 40z UlPؔ$$0#< +HlT`a`dld nx02*,libz.so.1strcpydeflatestrerrorinflatememcpymallocfflush_initinflateInit_deflateInit_fopenmemsetfclose_finifputcfwrite__errno_locationstrlen__data_startinflateEnd_Jv_RegisterClassesdeflateEndfree__fputc_unlockedliblzo2.so.2memmovelzo1x_decompress_safelzo1x_999_compressraiseabortlibc.so.0stdoutgetopt_long__ctype_bdirnameperrorreadlinkputsisattyoptargstrtolbasenamecallocfstatchdirscandirlstatreadstrncmpalphasortreallocsscanf__uClibc_mainstrduptimestrcmpgetcwdasprintfstderrexitfilenogetlinestrspnvfprintf__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__pt x:     $(,048<@DHLPT X!\"`$d&h'l(p)t*x+|,-./1235689;<?@ABCđDȑȆGБIԑJؑKܑLMN -L-ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(  --- 0oxp̍GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/ᄔ-(M0 S R/Ѝ/UO-MP,0y0SG p 0|C \ p0` p\0* R,@ V p" 0S Q \ 0 p0 P0 CR* X ߍ000A-M@p ,#\`* @ P<@U @ 8C8T  @ R@@\`:܍ @p@-xPU" `t@,PT P &P "P  t`: S```p`t@PTp80p@-4@`P$$  p@p-- M P0H R P 03045*  뀔0@-M@O0p03T0SP Ѝ0-- M  P H0S 0\01045* ЍЍ/ꀔp@-@PHPT`@ 000RP@0 p@( -- M00b-- M00 ЍЍ/0P@-@ *@P rA-p` : SP'tPU  P V P@8 P P /\x0SPxPU@-<<<@ ,0@ R |THA-PR`dpPdU0`0 @P0,wPdU0`0褔0@-@PM  Y@j `D i9UP( YQ @ P@`0@`` T( ᘑ, ̠8 ̠@ T(dᘁP嘐P夐<`ld Tᘐ ĉᐐH 尐.$D!`"#,a @@@0圑^ 0 i1P 0ppd@0h$\7U@@ ^  .4, ̃0 iE'P 0$6@UPPȂ ^  8,#Ġ L0 i0pp&tF R  @X6XĂUXl ^a9  x@ XA@4`1@0a501P-`,0tQ4T<2P Q6.PpQP83P aQ7xQ/X@Q$ tDKⰒᲂ( L+ .? c axh h`0 N  ?#Ϡ  l a 0LHDؓPG-eHM@嬥p ppb&4&&^0) @ t hM^R&H@D&L`D DM0Z z|PG.F$Pᴐt"Ƞ @Q0 ! "M^Z H$\$ <)ȠẐ H$\$ <@$Ƞ@X%4$ ̃P%HAQ8@P,.4Ă 0#("2HHX!4  $.Ƞ@$Ġ%8#4,$  (", 8,#4$ <0$%#H ̠B1!ᴃ0ß)㸃ᶓP<Q 0! "MpZ X,%4D FG0!@q!' L (tT,,R 8,(4$^/ prpBEQ`{ @>FT8B*Q (3QT D  F  1. a nHЍAq封@FTA XPἐᾐ01C!B!T @RẔ㼒42!Aᴃgf]=EF  0 B  Ϡ0, a lxh hz` @ w Ϡ,? c a jmꠔ0LHDؓPO-pDlM`p$P PP7D 0@M0 R z|PG.#RᶒP(  pQ@%!%T"M\ @8# |,$%̂$\p0,p00@8@ ,Ă$\ p8p0Hp@P0(d Ƞ `l.L\dP@("$$<'\p@ !,Ġ'  . P$| 0`L sD0HP@`$`4 T`X` <Q@ Q %M>pQ (L"TĎ l Rdp`W+ bBQqa @ DTA&\  Q: D   Ϡ1, a ltlЍ\ATaXq@ DT4A 0,P@00 8H8 A `CDLH@`f==ND ᶒ' h  A  0!  0n cxWhp hQ`0 Ap  ?# a l Aꠔ0LHDؓPO-Mt0S x R  M@@ S  S  S3  lt0S0 0 : Sr S  S  SP,@t?  p(J .̾@0p xΟfM0 ,D |0*S.  (" << 8#  LD> Ƞ  Ġ  .H R@D ., Q$8 8,#D PH * ā L X@ L!4Ą , T, 8L,#Ġ $ LĬ(, CP@ $\,M `V ̟ Q ̟,L` VhQ \< Q D \ >` @-PM`@pT"@T P p Q W0SQ P@@ <0 8Ѝ@@`8 Q B aB Q' 00`BS&(   QQ11"1:QQ11 1:S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3/Q!! # 3 Q!! "Q!! "Q \3`B/-/@-@A/@-@/ -L0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-rtime%s%s %s: mkfs.jffs2memory exhaustedLoad next block : %d bytes read writewrite returned zeroWrong bitmask at 0x%08x, 0x%04x Obsolete%8s Inode node at 0x%08x, totlen 0x%08x, #ino %5d, version %5d, isize %8d, csize %8d, dsize %8d, offset %8d %8s Dirent node at 0x%08x, totlen 0x%08x, #pino %5d, version %5d, #ino %8d, nsize %8d, name %s %8s Cleanmarker at 0x%08x, totlen 0x%08x %8s Padding node at 0x%08x, totlen 0x%08x %8s Unknown node at 0x%08x, totlen 0x%08x out of memory%s:%s%s: file type does not match specified type!%s: does not exist!Note: ignoring directories below '%s' opening directory %s%s/%s/%s%sUnknown file type %o for %s d %04o %9lu %5d:%-3d %s s %04o %9lu %5d:%-3d %s p %04o %9lu %5d:%-3d %s c %04o %4d,%4d %5d:%-3d %s b %04o %4d,%4d %5d:%-3d %s l %04o %9lu %5d:%-3d %s -> %s symlink too large. Truncated to %d chars.Skipping file "%s" too large.%s: open fileread f %04o %9lu (%9u) %5d:%-3d %s Unknown mode %o for %sr%s: not a proper device table fileroot directory specified more than onceNote: Adding '%s' to ignore Path --------- Dumping ignore path list ---------------- * '%s' ---------------------------------------------------output filename specified more than onceopen output filerevision %s Unrecognisable erase size KiBMiBUnknown units in erasesize Erase size 0x%x too small. Increasing to 8KiB minimum cleanmarker size must be >= 12cleanmarker size must be < eraseblock sizeUnknown compression mode %sUnknown compressor name %s %s%d:%sCannot parse %s(incremental) filename specified more than oncecannot open (incremental) fileD:d:r:s:I:o:qUPfh?vVe:lbp::nc:m:x:X:Lty:i:getcwd failed %as %c %lo %lu %lu %lu %lu %lu %lu %luDevice table entries require absolute pathsUnsupported file typeskipping device_table entry '%s': no parent directory!%s%lu%s/%s%lu %sCompression errors: %d Usage: mkfs.jffs2 [OPTIONS] Make a JFFS2 file system image from an existing directory tree Options: -p, --pad[=SIZE] Pad output to SIZE bytes with 0xFF. If SIZE is not specified, the output is padded to the end of the final erase block -r, -d, --root=DIR Build file system from directory DIR (default: cwd) -s, --pagesize=SIZE Use page size (max data node size) SIZE (default: 4KiB) -e, --eraseblock=SIZE Use erase block size SIZE (default: 64KiB) -c, --cleanmarker=SIZE Size of cleanmarker (default 12) -m, --compr-mode=MODE Select compression mode (default: priortiry) -x, --disable-compressor=COMPRESSOR_NAME Disable a compressor -X, --enable-compressor=COMPRESSOR_NAME Enable a compressor -y, --compressor-priority=PRIORITY:COMPRESSOR_NAME Set the priority of a compressor -L, --list-compressors Show the list of the avaiable compressors -t, --test-compression Call decompress and compare with the original (for test) -n, --no-cleanmarkers Don't add a cleanmarker to every eraseblock -I, --ignore=PATH Ignore sub directory and file tree below PATH when recursing over the file system -o, --output=FILE Output to FILE (default: stdout) -l, --little-endian Create a little-endian filesystem -b, --big-endian Create a big-endian filesystem -D, --devtable=FILE Use the named FILE as a device table file -f, --faketime Change all file times to '0' for regression testing -q, --squash Squash permissions and owners making all files be owned by root -U, --squash-uids Squash owners making all files be owned by root -P, --squash-perms Squash permissions on all files -h, --help Display this help text -v, --verbose Verbose operation -V, --version Display version information -i, --incremental=FILE Parse FILE and generate appendage output for it 1.60padrootpagesizeeraseblockignoreoutputhelpverboseversionbig-endianlittle-endianno-cleanmarkerscleanmarkersquashsquash-uidssquash-permsfaketimedevtablecompression-modedisable-compressortest-compressioncompressor-priorityincremental@@1.2.3zliblzononeprioritysizefavourlzoCompression mode: unkown Compressors: %10s compr: %d blocks (%d) decompr: %d blocks %10s (prio:%d) compr: %d blocks (%d/%d) decompr: %d blocks %10s priority:%d disabledenabledmkfs.jffs2: Compressor modul is in use. Unregister failed. COMPR_ERROR: buffer overflow at %s. (bs=%d csize=%d b[%d]=%d) No memory for buffer allocation. Compression check disabled. JFFS2 compression check: there is no decompress function at %s. JFFS2 compression check: decompression failed at %s. JFFS2 compression check: data mismatch at %s (pos %d). mkfs.jffs2: No memory for compressor allocation. Compression failed. mkfs.jffs2: No memory for compressor allocation. (%d bytes) mkfs.jffs2: unknow compression mode. NULL compressor name at registering JFFS2 compressor. Failed. mkfs.jffs2: compressor %s not found. T86 ̍ x@P  ̋  ܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍܍2@. HpPrXshexIohvVblncqUPfD(m@xXtpyi<PL``Aaeabi5TE mkfs.jffs2 }m.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink H PP!@@ ) ̋ 2  ;̍ 6܍ A`GxxqMqU` `_kw|  plhpl070701002ECD750000A1FF00000000000000000000000147CEFAFA00000011000000080000001100000000000000000000001000000000usr/bin/strings../../bin/busybox070701002ECC9C0000A1FF00000000000000000000000147CEFAEF00000011000000080000001100000000000000000000000F00000000usr/bin/md5sum../../bin/busybox070701002ECE1C0000A1FF00000000000000000000000147CEFAFD0000000D000000080000001100000000000000000000000D00000000usr/bin/lastlast.sysvinit070701002ECDB80000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000000E00000000usr/bin/which../../bin/busybox070701002EC858000081ED00000000000000000000000147CEEB9F00000D00000000080000001100000000000000000000001500000000usr/bin/flash_unlockELF(4h 4 (444tttttQtd/lib/ld-uClibc.so.0    DTgpYpP`\0LP h4'tz5sn<AdF|S0abortlibc.so.0ioctlfprintfstrncmp__uClibc_mainstderrexitopen__data_startclose__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__\`dh l ptx -L-ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ  --- 0넆t GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/-(M0 S R/Ѝ/|p@-P(MP`@ P@P 0P 0$P(Ѝp dd0T  H @0P 갆M M@ H -LUSAGE: %s /dev/mtd'%s' is not a MTD device. Must specify mtd device: /dev/mtd? Could not open mtd device: %s Could not get MTD device info from %s Could not unlock MTD device: %s 8 tx0 P@؃00000000Aaeabi5TE flash_unlockp.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  P!00) ؃2 @; 600tAGM2Upp_ttkxxw|||PP,||p070701002EC99D0000A1FF00000000000000000000000147CEFAE200000011000000080000001100000000000000000000000B00000000usr/bin/dc../../bin/busybox070701002ECDB70000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000000C00000000usr/bin/tty../../bin/busybox070701002EC881000081ED00000000000000000000000147CEEB9F00002DB0000000080000001100000000000000000000001700000000usr/bin/flash_eraseallELF(4)4 (p$'$$4448'8'8'8'8'\D'D'D'Qtd/lib/ld-uClibc.so.0>"    ! P0X<THL^(eT8n` 4(zl (x$0&`00((P (&((((̇$؇d(, @libgcc_s.so.1__aeabi_unwind_cpp_pr0abort_Jv_RegisterClassesraiselibc.so.0putcharioctlstdoutstrerrorgetopt_longputsfflushlseekfprintfoptind__uClibc_mainstderrfwrite__errno_locationexitopen__data_start__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__GCC_3.5U&y .(((@(D(H(L(P(T( X( \( `(d(h(l(p(t(x(|((! -L-Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ  --- 0̈ GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/(-(M0 S R/Ѝ/@'O-@7@ `IMPp G 7p jP P ?PqPԶ@@AT Tyk0WM Z xF pv`v }pPPH NPBF0Q1P @AP 0*0SI ?E/,P15P ZH  5  1PbP[  0R1hX @P0B/0P?䴟 Rd$@P` 0Q d0,E:  P7` P 044@P` 04 _PZ Sß@`P 0t0SP Iߍhcl@P` 0xzpSM.Pb 0Cz2!Z0M>P  L!   B +0\ +M>\ 8,#Ġ ,  Ġ   Jl HPl^% 0S0 00 @S   S%  MΠ Q0! 00Aʠz00 0SI S 0HA *  0X'!P` 0 븀` 0P嘠p@ 0dXp 08P08  (((8(((M (M@(M M@HPp0( MȀ`hM`-Ѝ /A-Mpy`0("@PU` 0`ЍA/A-Mp `0("@PU` 0`ЍA/O-\$M PQ@0P`p Pp S`rp  WPVBV*VV#35!4000 s @ 0b43BR@% g x'x ,8HT*@K*TK2@0@b Q `8#8P*0`F*S`F2 V:PU*UU#35!3000 s@e6  0k8C13[%  Wx'x@$8HT*@H*TH2@0@b  `A 8#8P*`F*P`F20@d%'x'x@ $8HT*@I*TI2@0@b` 8#8P*0`F*S`F2 qWlW*WW#31 1000 0s0XP!#W*T0 c52@d8B<"0&  (@ $8HT\*@K*TK2@0@b  p8#8P*pG*P0pG2 b .Ƞ%8 8"H 8S  00TP N 0S p$ЍO/ԖPO-M P@S0pP RBR*RR#35!4000 s 0b03rR %Wx'x @ $8HT*@I*TI2@0@b`A 8#8P*0`F*S`F2 RPU*UU#35!3000 s@e6  0k7C13[{%p x'x@ $8HT*@I*TI2@0@b`8#8P*`F*P`F20 @d %x'x @ $8HT*@I*TI2@0@b` 8#8P*0`F*S`F2 qSlS*SS#31 1000 0s0 WR!#W*T0@ c52 d7B0"0&s pO ( p'8HTP*@K*TK2@0@b 7 pr@8#8P*pG*P0pG2 b .Ƞ%8 8"H 8S  P00TP N ЍO/dP Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/-/@-@A/@-@/ -L0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Usage: %s [OPTION] MTD_DEVICE Erases all of the specified MTD device. -j, --jffs2 format the device for jffs2 -q, --quiet don't display progress messages --silent same as --quiet --help display this help and exit --version output version information and exit flash_eraseall $Revision: 1.22 $ Copyright (C) 2000 Arcom Control Systems Ltd flash_eraseall comes with NO WARRANTY to the extent permitted by law. You may redistribute copies of flash_eraseall under the terms of the GNU General Public Licence. See the file `COPYING' for more information.%s: no MTD device specified Try `%s --help' for more information. %s: %s: %s %s: %s: unable to get MTD device info %s: %s: unable to get NAND oobinfo Eeep. Autoplacement selected and no empty space in oob Skipping bad block at 0x%08x %s: %s: Bad block check not available %s: %s: MTD get bad block failed: %s Erasing %d Kibyte @ %x -- %2llu %% complete. %s: %s: MTD Erase failure: %s %s: %s: MTD writeoob failure: %s %s: %s: MTD lseek failure: %s %s: %s: MTD write failure: %s Cleanmarker written at %x.helpversionjffs2quietsilentjqjqq(tF 8'<'(Є 6 4(loLooD'$Aaeabi5TE flash_eraseall .shstrtab.interp.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink ((  !Є6)oD6oLL E llN  W R]ci qp$$' |44'8'8'<'<'@'@'D'D'4(4(T(( ((,p(((070701002EC9610000A1FF00000000000000000000000147CEFAE000000011000000080000001100000000000000000000000D00000000usr/bin/chvt../../bin/busybox070701002EC8EE0000A1FF00000000000000000000000147CEFADB00000011000000080000001100000000000000000000000A00000000usr/bin/[../../bin/busybox070701002EC8E7000081ED00000000000000000000000147CEEB9F000055F4000000080000001100000000000000000000001200000000usr/bin/jffs2dumpELF(4\R4 (444@P@P@P@P@P<tLPLPLPQtd/lib/ld-uClibc.so.06!      8(RDLP <R\ +hd2t7L >Q|Q<E0`K0Q0YQRP `0eȆ|QRsQ|QRzԆ dpQ0,memcpyabortlibc.so.0strcpygetopt_longperrorputsmallocoptarglseekwritefprintfoptindread__uClibc_mainstderrexitatoiopen__data_startclosefree__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__Q QQ(Q,Q0Q4Q8QT04 $  e P P Ƞ,d<,LLPdȠk,4L,\K\QP [:_EߍM.`ĎT (.804.`B^  4 `Q. L .   M>d(T 8#4,$ <00S Mn T8#4, <$   e0 `ʟM.4@P!H04Z !,R ]BPAUe0d(""\\@th&4 &P @ph,8#T D"pp ȉP.@q\.' MΠp`V  `@P8U  8,#4 , @ Rڼ P`@U 39j0R9 ȠLRR PR[ M P;  4Xh<`,.̠T#,0$ fXH8T `MΠT0PH  8̠,#d \0$!\!LL` ("4 "@P`( \8#D d%А Ph@.`\.)D7MΠ R P 0`D,)̠ T"L``0ȉ,.dL\" 00P H,h&4" ĉ ` h !Q "D6M@PU 0TH Hl$Ċ., P(N P5 @ PMd(\  Hl\$ ,PpM \("04",: 0R @C`R M \04!@tH@P8P ` ,`@ P`0\p p ( 48H 8 ,(p $\(@ X%d,x<,'dTXPD`4$XTH,PD| Ď4$@$D tDX"LP l%T d#\P@0 ̎!"L%L@, .l$|%,4,(<0` p0 < .. 00$d$x 0 ` p `% `P  @ P@P4h*̠,.L!!4!hP0`  0"@t@PP ` 0` @ P`p p |p堠 ጠ ဠ|@ 4 Ƞ8pP (,d<,(tl娠p`删xl娠H,ᤠ嘠|X 唠x l t$Dl#L%T0 d"\. P ̊!@%h,%|,4%". ,($lt``pd0 0..0$d$x ` pt h  d00 @P`PPmR@RQQQxQ<$h&TL& 0$h&TL& 0P`$H, 4\d"L P@`.0\. MΠP@T 0$Ȃ,h&4 "̃``0$Ȃ,h&4 "̃``0$Ȃ,h&4 "̃``0$..ln0$..ln0$Ȃ,h&4 "̃`` !0"#$Ȃ,h&4 "̃``$%0&'$Ȃ,h&4 "̃``()0*+$Ȃ,h&4 "̃``,-0./$Ȃ,h&4 "̃``01023$Ȃ,h&4 "̃``45067$Ȃ,h&4 89`" !a:;3$h&Ġ< & Q 01 23`ȎT  ̠!dT <PC J  D0Q,P !,"MnT \P` 4< fh&Ġ ,NL\!d. PD*4 *` T*D<*  `@T,8#d T"LР0 @% .a\.&deM^@\ 0P@d,!̠ T"l@@0Ċ(LX%l $̊P0`@$ 4̠T.l@@ P ,P8l#LP" ``PP `@  ! Q "6M R6 &P 0(PSC J (` @ 0 Q .0M. Q L( `MN4@(\  8#Ġd ,%`@ i7` $XQ <@=>`?( 8#D\d. ` 8(.0 Q<Q.%\MN@PUP; D 6 `4P  (l"4 ̃A @D 0`ăXV ̠,!d.<, TD.<I\\\) l!4Ā., `Pe P 0@( <!Dl#̄@ @ `8 l, & $ $4$h $ $ 0``@0M$ Ȃ^  8L#Ġ , !PC J @j $ Q,+M^&  븠P  $%&'P Ȁ,8#Ll" PP(P8 , #TD,-( l " ,<l!D < l\!DĆ 8L#.,aO-DIMMMhlPO.0 [5*嬎Q4@( "8 T04 ",80CR. [ n n`$ P!(04!f=@Q, PUw lB.DNl0 [:NQ hl" Ѝۍ 0 T4(8"H@D ",@CRhh@ PĎ ("804"<h& `` P0 4)4 0!!\@P@  Q0,P,  0 P 48 U 8#4,$ <00 S L U8#4, <$  n d 0lbP`lbVt̟ P04"$ `$ } U4ʠ.$ 0R# C0R 0CR \K@ 4 \  8L,#ĠT P 0 |t;VH U` | P0@`$ 8<\(,`QlXa`a\LD\a\TXa! ,Ġ'" #̌pPB`0 dt   Q0,!,"0 PH ^ 8#4,$ <00 S $* ^8#4, <$   n 0 0DX \  X%4, LPlPlJRA @ R pR @y@T @$8 9 V U X%4LT ,0 l@ 4 \  !4,LĂ PlPlS HxDT(VX UP 8lXpbR P 0HR 0-`1@5P04,apČDr`,bp r2`a6pq.`ap@r`(bpr3`DRAa7pAqHr/`4ra0b r$8,bQ@r(ȌaR<(Bqa,̌Axrx  qhpr$bhahalPb$b|8r&tlpR rbrH$D'dba|q&tqqla'daa |q&tqprlalTb|l?T( ^ 8#4,$ <00\3 v ^8@,#4$ <   d 0P  \ 0 H$T,Ă 0lPld @P 0 10454$-p,xp``pp``2pp6``.ptp``pp``3p@Pp7`|`/p`@ppxpČP`p8(@tP`pȌ@\l ||0Lp̌ ` ^ " ("4|ć @ DPTP`@P0`` 4 ppp8@ <d\P| ppl` dp弐(L."$,Ġ\T D!,#̌ |0 @P`pX P  PDx ^| P p 0   @P Dqp4qPqt (|R 8D4A|r  <,H|\| 0S> SDoP/ lPM>0rP0   vP @ 0bSQ  !` Ѝ4H?P8RxQQQQQQRQRR -L Mt1p@  PQ 4aP (~xQ 0S P@T̠Yw p0 `p孁!4 QW  [4 W 0apW0RRRRRRQ -L%8s Inode node at 0x%08x, totlen 0x%08x, #ino %5d, version %5d, isize %8d, csize %8d, dsize %8d, offset %8d Wrong node_crc at 0x%08x, 0x%08x instead of 0x%08x Wrong data_crc at 0x%08x, 0x%08x instead of 0x%08x %8s Dirent node at 0x%08x, totlen 0x%08x, #pino %5d, version %5d, #ino %8d, nsize %8d, name %s Wrong name_crc at 0x%08x, 0x%08x instead of 0x%08x %8s Inode Sum node at 0x%08x, totlen 0x%08x, sum_num %5d, cleanmarker size %5d %14s #ino %5d, version %5d, offset 0x%08x, totlen 0x%08x %14s dirent offset 0x%08x, totlen 0x%08x, #pino %5d, version %5d, #ino %8d, nsize %8d, name %s Unknown summary node!%14s Sum Node Offset 0x%08x, Magic 0x%08x, Padded size 0x%08x %8s Cleanmarker at 0x%08x, totlen 0x%08x %8s Padding node at 0x%08x, totlen 0x%08x %8s Unknown node at 0x%08x, totlen 0x%08x Empty space: %d, dirty space: %d jffs2dump $Revision: 1.10 $ Copyright (C) 2003 Thomas Gleixner jffs2dump comes with NO WARRANTY to the extent permitted by law. You may redistribute copies of jffs2dump under the terms of the GNU General Public Licence. See the file `COPYING' for more information.Usage: dumpjffs2 [OPTION] INPUTFILE Dumps the contents of a binary JFFS2 image. --help display this help and exit --version output version information and exit -b --bigendian image is big endian -l --littleendian image is little endian -c --content dump image contents -e fname --endianconvert=fname convert image endianness, output to file fname -r --recalccrc recalc name and data crc on endian conversion -d len --datsize=len size of data chunks, when oob data in binary image (NAND only) -o len --oobsize=len size of oob data chunk in binary image (NAND only) -v --verbose verbose outputCannot open / create file: %s Wrong bitmask at 0x%08x, 0x%04x Wrong hdr_crc at 0x%08x, 0x%08x instead of 0x%08x Unknown node in summary information!!! nodetype(%x) Unknown node type: 0x%04x at 0x%08x, totlen 0x%08x Empty space found from 0x%08x to 0x%08x Obsoleteopen input fileout of memoryPeeling data out of combined data/oob imagehelpversionbigendianlittleendiancontentendianconvertdatsizeoobsizerecalccrcverboseblce:rd:o:vb(l8c@ePdXo`rpvx0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-  @PDP|l QlLP$$$$$$$$$$$$$$$$$$Aaeabi5TE jffs2dumpL'Ԛ.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink d ll!||) ll2 ;6$$A:GAMA|U<0F@PP M0R<`$PgHnXs̆<Pz؆d40abortraiselibc.so.0putcharioctlperrorputsmalloclseekfprintfoptindread__uClibc_maingetoptstderrstatfwriteexitopen__data_startclose__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__@H    $(,0 -L-崋ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,  --- 0P| GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/L-(M0 S R/Ѝ/ 0ˠ$S@&,ˠR \  S# #ph`@-$@ 0 @HA-PBM@`$$p hP` vP#`ypVsE0P VsjP   jpPA`t=\h 2`P X4YQ@!xA\ `;`S pR `D pI | R ^0Q(BQ1 p P p-  p$ W 0  p0 pP 0P @P  W 0rpnn8Pk50` 0d.갎@M ЎH0H`hȏP8p(x Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/-/@-@A/@-,@/ -L%d mb%d kb%d bytesusage: %s [-v] device -v verbose messages vhstatus check failed%s is not a character special device open failedget info failedMemory region info: Region size = Erase block size = seek failedNo valid erase unit headers! Partition header: Formatted size = , erase units = %d, transfer units = %d Erase unit size = , virtual block size = read failed Erase unit %d: Erase unit header is corrupt. Transfer unit, erase count = %d Logical unit %d, erase count = %d Block allocation: %d control, %d data, %d free, %d deleted  P |lAaeabi5TE ftl_checkL֮.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink | !) ll2 ||; 6AHGPPM2``U_kw  |T44@<p<Wg070701002ECD550000A1FF00000000000000000000000147CEFAF900000011000000080000001100000000000000000000000C00000000usr/bin/seq../../bin/busybox070701002EC88E000081ED00000000000000000000000147CEEAF100001ABC000000080000001100000000000000000000001100000000usr/bin/utmpdumpELF(4$4 (444`Qtd/lib/ld-uClibc.so.0L-$"() %+ *!' & ,#  IDLHL@)P\ /hd6t;L B1D`H0P$Z `P?gXmȈP tԈ|0 %D$4(4@$K`LXDdp|<,memcpyabortlibc.so.0stdout__ctype_bfgetsperrorputsmallocsleepfprintfinet_addrfseekoptindstdinmktimestrncpysscanffread__uClibc_mainfopengetoptlocaltimememsetfcloseinet_ntoastderrstrftimefwritestrptimeexitstrchr__data_startfree__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__HLPX`#     !$$(%,(0)4*8, -L-倍ƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ  --- 0댓ܑ GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/d-(M0 S R/Ѝ/0@-\ Q\@?P [\ ]\ \ P 0 @P\0L0S S Q/1 R RQ00/@-@QE-M[@`pPJ0@]PPJV``  xP` HЍ 0% _c`(M0@- usage: %s [ -v | --verbose ] %s -h | --help -h | --help Show this help message -v | --verbose Show progress reports File which you want to copy to flash Flash device to write to (e.g. /dev/mtd0, /dev/mtd1, etc.) This doesn't seem to be a valid MTD flash device! While trying to get the file status of %s: %m %s won't fit into %s! Erasing blocks: 0/%d (0%%) Erasing blocks: %d/%d (%d%%)While erasing blocks 0x%.8x-0x%.8x on %s: %m Erasing blocks: %d/%d (100%%) Writing data: 0k/%luk (0%%)While erasing blocks from 0x%.8x-0x%.8x on %s: %m Writing data: %dk/%luk (%lu%%)While writing data to 0x%.8x-0x%.8x on %s: %m Short write count returned while writing to x%.8x-0x%.8x on %s: %d/%lu bytes written to flash Writing data: %luk/%luk (100%%) Verifying data: 0k/%luk (0%%) Verifying data: %dk/%luk (%lu%%)File does not seem to match flash data. First mismatch at 0x%.8x-0x%.8x Verifying data: %luk/%luk (100%%) helpverbosehvxhvlP 0XX `HAaeabi5TE flashcpM.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink P XX!XX) HH2 ``;6A؆X G00M@@UĘ_kw|Pp +070701002EC8EA000081ED00000000000000000000000147CEEB9F00001DDC000000080000001100000000000000000000001200000000usr/bin/mtd_debugELF(4D4 (444HTA(((Qtd/lib/ld-uClibc.so.0A#!    " TGLpYd$ȆL d+Ԇ0`18P@0F0pYP NV(0U4[@iL doXpYvd}hdpYpj|d\p0,abortlibc.so.0ioctlperrorcreatmalloclseekstrtolstrrchrwritefprintfferrorfread__uClibc_mainfopenfclosestrcmpstderrexit__data_startfree__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__h    $ (,048<@DHLPT!X" -L-dƏ ʌdƏ ʌ\Ə ʌTƏ ʌLƏ ʌDƏ ʌ<Ə ʌ4Ə ʌ,Ə ʌ$Ə ʌƏ ʌƏ ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ  --- 0̒tGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/l-(M0 S R/Ѝ/$-(0 M  0h@-@hxTT0 R \ $ET 0RJ @_蘓0@- MP@H P@OP 00,(d Ѝ0HM@hp@-0M `6P&, 0P,0StR@,PP @ PP@ P8 Qotċ0Ѝp  RS  Rc  Rd  Ri Q@PP@Q   U@Qlb`^TZH V<,, RP@ 0G  0,0@PS R|pM MpM ؗ(@P`P@`p80ȔO-M 0 y[ lЍP @ :x8Tdd!@, p\`PHQ0D8! PT@ 0ipW ^P RP&PdUo^  0, +S%0l P4|Q@D 0X0 P%H B1Еؕh 0PXxO-p M Z  ЍP@ 48TTT!@( `P8Q04(! PT@ P P&TPd-U  00t P L 0`8 PP$0 8@Еh@ ؖXxp@-P@`/PPT T T" @PP!a|P@D @dP@ L{P@0sP@0DSȑh,@jP0` ;@ 6 0@ +@ & @ @  0 @ꘗx -Lusage: %s info %s read %s write %s erase %u (%u%c)MEMERASEErased %d bytes from address 0x%.8x in flash MEMGETINFOMEMGETREGIONCOUNTmtd.type = MTD_ABSENTMTD_RAMMTD_ROMMTD_NORFLASHMTD_NANDFLASHMTD_DATAFLASH(unknown type - new MTD API maybe?) mtd.flags = MTD_CAP_ROMMTD_CAP_RAMMTD_CAP_NORFLASHMTD_CAP_NANDFLASH | %s mtd.size = mtd.erasesize = mtd.writesize = mtd.oobsize = regions = %d region[%d].offset = 0x%.8x region[%d].erasesize = region[%d].numblocks = %d region[%d].regionindex = %d lseek()rfopen()%s: malloc(%#x) failed %s: trying buffer size %#x malloc()%s: fread, size %#x, n %#x fread()%s: write, size %#x, n %#x write()Copied %d bytes from %s to address 0x%.8x in flash creat()%s: malloc(%#x) %s: read, size %#x, n %#x read()Couldn't copy entire buffer to %s. (%d/%d bytes copied) Copied %d bytes from address 0x%.8x in flash to %s inforeadwriteeraseopen()close()MTD_WRITEABLEMTD_BIT_WRITEABLEKMGTfile_to_flashflash_to_fileЗ4 t ̒ Є ą(Aaeabi5TE mtd_debugL.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  0!Є) 2 ą;tt6A, G̒M8U_k  w$$|((d\\hd@pd070701002ECDE40000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000000F00000000usr/bin/uptime../../bin/busybox070701002ECBC90000A1FF00000000000000000000000147CEFAE800000011000000080000001100000000000000000000001000000000usr/bin/hexdump../../bin/busybox070701002ECD2D0000A1FF00000000000000000000000147CEFAF800000011000000080000001100000000000000000000000F00000000usr/bin/printf../../bin/busybox070701002EC8EB000081ED00000000000000000000000147CEEB9F00001CCC000000080000001100000000000000000000001300000000usr/bin/ftl_formatELF(`444 (444XQtd/lib/ld-uClibc.so.0R,! '% #&()+$* "  (&4Th@LX),LX 2dd9p>|L E`TLT[0`a0gĈ0od(vh`P |ЈT܈$84p XTx$0dL<0HTmemcpyabortraiselibc.so.0putcharioctlfgetsperrorputsmallocoptargstrtoulfflushlseekwritefprintfoptindstdin__uClibc_maingetoptmemsettimestrcmpstderrfputcstat__stdoutexitopen__data_startclose__fputc_unlocked__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__X` dhp x$     $(,0!4"8&<'@)D*H+ -L-崏ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌ  --- 0pGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/|-(M0 S R/Ѝ/0ˠ$S@&,ˠR \ u S#o #lꐔO-$xM`P 'p@& b0DS3<ċċċċċċċċċċċċċ̋ԋ N @l'KTkTYp@X@wF`P ,,WDZ ( " AP (   >p`40| P h@YP L$PD t  tp y0Gep@@0 U0PU 0lA\g0Np7, P|0HHᾈd%@e pl@^㣂.0 PcP@弈 IY ^ ğ@ P PpĠ0 :AP@5GT 00 !0TY pXHp Tv DtPؠ^. DP H RF 0[-03045:-YHPTV 9P60Y [Q \H@T   R+0304 5:+aH0S  ^*03045:*S !-:+7YHX @P 03045: 9"@ Y`rHZC PU 0304P5: ,8H \ PU`*H 0B pS p QtD 㸸p  p=  p HP H뾈U/*@, $  Z ዠ 娰v lPp@umx*`dpHM XQh@xXM@ hȖPhЕH Q/6:P"# 00QQ1121:QQ1101: P@  !P@ !!P!@ #!!P@ !!P#2!//Q!! # 3 Q!! "Q!! "Q 0/-/@-@A/@-7@/ -L%d mb%d kb%d bytesqir:s:b:usage: %s [-q] [-i] [-s spare-blocks] [-r reserve-percent] [-b bootsize] device status check failed%s is not a character special device open failedget info failedPartition size = , erase unit size = , %d transfer units allocated for boot imageReserved %d%%, formatted size = This will destroy all data on the target device. Confirm (y/n): y Y Erasing all blocks...block erase failedseek failedwrite failedformat failed.format successful.Writing erase unit headers...CISF9FTL100؉  pȅ < 40Aaeabi5TE ftl_formata.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  !ȅ<) 02 44;6LA``  GppMwU_kw|tLLXT(pTo070701002EC7AC000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000A00000000usr/games070701002EC7AD000041ED00000000000000000000000247CEFAFC00000000000000080000001100000000000000000000000900000000usr/sbin070701002EC8A7000081ED00000000000000000000000147CEEAEA00001098000000080000001100000000000000000000001D00000000usr/sbin/update-alternatives#!/bin/sh # update-alternatives # # Copyright (C) 2001 Carl D. Worth # # This program was inspired by the Debian update-alternatives program # which is Copyright (C) 1995 Ian Jackson. This version of # update-alternatives is command-line compatible with Debian's for a # subset of the options, (only --install, --remove, and --help) # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. set -e # admin dir ad="$IPKG_OFFLINE_ROOT/usr/lib/ipkg/alternatives" usage() { echo "update-alternatives: $* Usage: update-alternatives --install update-alternatives --remove update-alternatives --help is the link pointing to the provided path (ie. /usr/bin/foo). is the name in $ad/alternatives (ie. foo) is the name referred to (ie. /usr/bin/foo-extra-spiffy) is an integer; options with higher numbers are chosen. " >&2 exit 2 } quit() { echo "update-alternatives: $*" >&2 exit 2 } register_alt() { [ $# -lt 2 ] && return 1 local name="$1" local link="$2" if [ ! -d $ad ]; then mkdir -p $ad fi if [ -e "$ad/$name" ]; then local olink=`head -n 1 $ad/$name` if [ "$link" != "$olink" ]; then echo "update-alternatives: Error: cannot register alternative $name to $link since it is already registered to $olink" >&2 return 1 fi else echo "$link" > "$ad/$name" fi return 0 } protect_slashes() { sed -e 's/\//\\\//g' } remove_alt() { [ $# -lt 2 ] && return 1 local name="$1" local path="$2" [ ! -f $ad/$name ] && return 0 path=`echo $path | protect_slashes` sed -ne "/^$path\>.*/!p" $ad/$name > $ad/$name.new mv $ad/$name.new $ad/$name } add_alt() { [ $# -lt 3 ] && return 1 local name="$1" local path="$2" local priority="$3" remove_alt $name $path echo "$path $priority" >> $ad/$name } find_best_alt() { [ $# -lt 1 ] && return 1 [ ! -f $ad/$name ] && return 0 link=$IPKG_OFFLINE_ROOT/`head -n 1 $ad/$name` ## path=`sed -ne "1!p" $ad/$name | sort -nr -k2 | head -1 | sed 's/ .*//'` ## busybox safe: path=`sed -ne "1!p" $ad/$name | sed -e "s/\(.*\) \(.*\)/\2 \1/g" | sort -nr | head -n 1 | sed 's/[^ ]* //'` if [ -z "$path" ]; then echo "update-alternatives: removing $link as no more alternatives exist for it" rm $ad/$name if [ -L $link ]; then rm $link fi return 0 fi if [ ! -e $link -o -L $link ]; then local link_dir=`dirname $link` if [ ! -d $link_dir ]; then mkdir -p $link_dir fi ln -sf $path $link echo "update-alternatives: Linking $link to $path" else echo "update-alternatives: Error: not linking $link to $path since $link exists and is not a link" return 1 fi return 0 } do_install() { if [ $# -lt 4 ]; then usage "--install needs " fi local link="$1" local name="$2" local path="$3" local priority="$4" path=`echo $path | sed 's|/\+|/|g'` # This is a bad hack, but I haven't thought of a cleaner solution yet... [ -n "$IPKG_OFFLINE_ROOT" ] && path=`echo $path | sed "s|^$IPKG_OFFLINE_ROOT/*|/|"` register_alt $name $link add_alt $name $path $priority find_best_alt $name } do_remove() { if [ $# -lt 2 ]; then usage "--remove needs " fi local name="$1" local path="$2" path=`echo $path | sed 's|/\+|/|g'` # This is a bad hack, but I haven't thought of a cleaner solution yet... [ -n "$IPKG_OFFLINE_ROOT" ] && path=`echo $path | sed "s|^$IPKG_OFFLINE_ROOT/*|/|"` remove_alt $name $path find_best_alt $name } ### # update-alternatives "main" ### while [ $# -gt 0 ]; do arg="$1" shift case $arg in --help) usage "help:" exit 0 ;; --install) do_install $* exit $? ;; --remove) do_remove $* exit $? ;; *) usage "unknown argument \`$arg'" ;; esac done usage "at least one of --install or --remove must appear" exit 0 070701002EC865000081ED00000000000000000000000147CEEAEA000018A7000000080000001100000000000000000000001600000000usr/sbin/update-inetd#!/usr/bin/perl # # update-inetd: a utility to add entries to the /etc/inetd.conf file # # Copyright (C) 1995 Peter Tobias # # update-inetd is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published # by the Free Software Foundation; either version 2 of the License, # or (at your option) any later version. # # update-inetd is distributed in the hope that it will be useful, but # WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with update-inetd; if not, write to the Free Software Foundation, # Inc., 675 Mass Ave, Cambridge, MA 02139, USA. # require 5.000; require DebianNet; # hack to make update-inetd work in a script which calls debconf if($ENV{DEBIAN_HAS_FRONTEND}) { my $file = ($ENV{DEBIAN_FRONTEND} eq 'noninteractive') ? '/dev/null' : '/dev/tty'; # see 4.13 changelog entry open(STDIN, "<$file") or die "Couldn't reopen stdin($file): $!"; open(STDOUT, ">$file") or die "Couldn't reopen stdout($file): $!"; open(STDERR, ">$file") or die "Couldn't reopen stderr($file): $!"; } $| = 1; $version = "1.12"; $0 =~ s#.*/##; while ($ARGV[0] =~ m/^-/) { $_ = shift(@ARGV); if (/--help$/) { &usage; } elsif (/--version$/) { &version; } elsif (/--add$/) { $mode="add"; } elsif (/--remove$/) { $mode="remove"; } elsif (/--enable$/) { $mode="enable"; } elsif (/--disable$/) { $mode="disable"; } elsif (/--multi$/) { $DebianNet::multi = "true"; } elsif (/--verbose$/) { $DebianNet::verbose = "true"; } elsif (/--debug$/) { $debug = "true"; } elsif (/--file$/) { $file = shift(@ARGV); die "$0: Option \`--file' requires an argument\n" unless ($file and not ($file =~ m/^--/)); $DebianNet::inetdcf = $file; } elsif (/--group$/) { $group = shift(@ARGV); die "$0: Option \`--group' requires an argument\n" unless ($group and not ($group =~ m/^--/)); } elsif (/--comment-chars$/) { $sep = shift(@ARGV); die "$0: Option \`--comment-chars' requires an argument\n" unless ($sep); die "$0: The comment characters do not start with a \`#'!\n" unless ($sep =~ /^#/); $DebianNet::sep = $sep; } elsif (/--pattern$/) { $pattern = shift(@ARGV); die "$0: Option \`--pattern' requires an argument\n" unless ($pattern and not ($pattern =~ m/^--/)); } else { print "$0: Unknown option: $_\n"; print "Try \`$0 --help' for more information.\n"; exit(1); } } $group = "OTHER" unless ($group); &usage unless($mode); # die "You must be root to run this script.\n" if ($> != 0); if ($#ARGV > 0) { print "Too many arguments!\n"; } elsif ($#ARGV == -1) { print "Too few arguments!\n"; } else { $modearg = $ARGV[0]; die "The service name may not include a whitespace character!\n" if (($mode eq "enable" or $mode eq "disable") and ($modearg =~ /\s+|\\t/)); die "The entry definition does not contain any whitespace characters!\n" if ($mode eq "add" and not ($modearg =~ /\s+|\\t/)); } print "Processing $DebianNet::inetdcf\n" if (defined($DebianNet::verbose)); print "Using mode \"$mode\", group \"$group\", pattern \"$pattern\" and seperator \"$DebianNet::sep\"\n" if (defined($debug)); print "Multiple remove/disable: $DebianNet::multi\n" if (defined($debug) and defined($DebianNet::multi)); print "ARGUMENT: $modearg\n" if (defined($debug)); if ($mode eq "add") { if (( -f "/etc/xinetd.conf" ) && ( -x "/usr/sbin/xinetd" )) { print "--------- IMPORTANT INFORMATION FOR XINETD USERS ----------\n"; print "The following line will be added to your /etc/inetd.conf file:\n\n"; print "$modearg\n\n"; print "If you are indeed using xinetd, you will have to convert the\n"; print "above into /etc/xinetd.conf format, and add it manually. See\n"; print "/usr/share/doc/xinetd/README.Debian for more information.\n"; print "-----------------------------------------------------------\n\n"; } DebianNet::add_service($modearg, $group); } elsif ($mode eq "remove") { DebianNet::remove_service($modearg); } elsif ($mode eq "enable") { @arglst = split(/,/, $modearg); while(@arglst) { $_ = shift(@arglst); DebianNet::enable_service($_, $pattern); } } elsif ($mode eq "disable") { @arglst = split(/,/, $modearg); while(@arglst) { $_ = shift(@arglst); DebianNet::disable_service($_, $pattern); } } else { die "Mode = \`$modearg'? This should not happen!\n"; } sub version { print "$0 $version\n"; print "DebianNet module $DebianNet::version\n"; exit(0); } sub usage { print < # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. initd="/etc/init.d" etcd="/etc/rc" notreally=0 force=0 dostart=0 verbose=0 usage() { cat >&2 <] remove update-rc.d [-n] [-r ] [-s] defaults [NN | sNN kNN] update-rc.d [-n] [-r ] [-s] start|stop NN runlvl [runlvl] [...] . -n: not really -f: force -v: verbose -r: alternate root path (default is /) -s: invoke start methods if appropriate to current runlevel EOF } checklinks() { local i dn fn remove=0 if [ "x$1" = "xremove" ]; then echo " Removing any system startup links for $bn ..." remove=1 fi for i in 0 1 2 3 4 5 6 7 8 9 S; do dn="${etcd}${i}.d" if [ ! -d $dn ]; then continue; fi for f in ${dn}/[SK]??${bn}; do if [ -L $f ]; then if [ $remove -eq 0 ]; then return 1 fi echo " $f" if [ $notreally -eq 1 ]; then continue fi rm $f fi done done return 0 } dolink() { startstop=$1 lev=`echo $2 | cut -d/ -f1` nn=`echo $2 | cut -d/ -f2` fn="${etcd}${lev}.d/${startstop}${nn}${bn}" [ $verbose -eq 1 ] && echo " $fn -> ../init.d/$bn" if [ $notreally -eq 0 ]; then mkdir -p `dirname $fn` ln -s ../init.d/$bn $fn fi if [ $dostart -eq 1 ] && [ $startstop = "S" ] && [ $lev = $RUNLEVEL ]; then $fn start || true fi } makelinks() { if ! checklinks; then echo " System startup links for $initd/$bn already exist." if [ $dostart -eq 1 ] && [ $notreally -eq 0 ] && [ -L ${etcd}${RUNLEVEL}.d/S??${bn} ]; then ${etcd}${RUNLEVEL}.d/S??${bn} restart || true fi exit 0 fi echo " Adding system startup for $initd/$bn." for i in $startlinks; do dolink S $i done for i in $stoplinks; do dolink K $i done } while [ $# -gt 0 ]; do case $1 in -n) notreally=1 shift continue ;; -v) verbose=1 shift continue ;; -f) force=1 shift continue ;; -s) dostart=1 shift continue ;; -r) shift root=$1 initd="${root}${initd}" etcd="${root}${etcd}" shift ;; -h | --help) usage exit 0 ;; -*) usage exit 1 ;; *) break ;; esac done if [ $# -lt 2 ]; then usage exit 1 fi bn=$1 shift if [ $1 != "remove" ]; then if [ ! -f "$initd/$bn" ]; then echo "update-rc.d: $initd/$bn: file does not exist" >&2 exit 1 fi else if [ -f "$initd/$bn" ]; then if [ $force -eq 1 ]; then echo "update-rc.d: $initd/$bn exists during rc.d purge (continuing)" >&2 else echo "update-rc.d: $initd/$bn exists during rc.d purge (use -f to force)" >&2 exit 1 fi fi fi if [ $dostart -eq 1 ]; then #RUNLEVEL=`sed 's/.*\[\(.*\)\]/\1/' < /proc/1/cmdline` RUNLEVEL=`runlevel | cut -d" " -f2` if [ "x$RUNLEVEL" = "x" ]; then echo "Unable to determine current runlevel" >&2 exit 1 fi fi case $1 in remove) checklinks "remove" ;; defaults) if [ $# -gt 3 ]; then echo "defaults takes only one or two arguments" >&2 usage exit 1 fi start=20 stop=20 if [ $# -gt 1 ]; then start=$2 stop=$2 fi if [ $# -gt 2 ]; then stop=$3 fi start=`printf %02d $start` stop=`printf %02d $stop` stoplinks="0/$stop 1/$stop 6/$stop" startlinks="2/$start 3/$start 4/$start 5/$start" makelinks ;; start | stop) while [ $# -gt 0 ]; do if [ $1 = "start" ]; then letter=S elif [ $1 = "stop" ]; then letter=K else echo "expected start or stop" >&2 usage exit 1 fi shift NN=`printf %02d $1` shift while [ "x$1" != "x." ]; do if [ $# -eq 0 ]; then echo "action with list of runlevels not terminated by \`.'" >&2 exit 1 fi level=$1 shift case $letter in S) startlinks="$startlinks $level/$NN" ;; K) stoplinks="$stoplinks $level/$NN" ;; esac done shift done makelinks ;; *) usage exit 1 ;; esac 070701002ECA930000A1FF00000000000000000000000147CEFAE500000011000000080000001100000000000000000000000F00000000usr/sbin/fbset../../bin/busybox070701002EC7F30000A1FF00000000000000000000000147CEFAFC00000011000000080000001100000000000000000000001000000000usr/sbin/udhcpd../../bin/busybox070701002EC8B6000081ED00000000000000000000000147CEEB630000197C000000080000001100000000000000000000001500000000usr/sbin/udevmonitorELF(44 (444`pQtd/lib/ld-uClibc.so.0K'%$#&   ! " (lL 4% 18:̇ F؇0+O0V0]4d< `k,0s84xD@*P P4\ht06 $`0abortlibc.so.0putcharstrcpyrecvsigemptysetstrerrorgetopt_longsnprintfgetpidgetuidsocketselectfprintfbindsetsockoptstrncmpsigaction__uClibc_maingettimeofdaymemsetstderr__errno_locationstrlenfputs__data_startclose__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__   "#$& -L-ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8  --- 0x$`GFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/ -(M0 S R/Ѝ/PP0  /G-p`PP  0Pp0=S0@ W:G-GM0Mp` PP@%5@Xp hP ePQkP uPLlNDPLP X D5Dn8J@ ^ 5* 0%2ʍ0 H D'U( |:`"pn a@@̍b>@ Tp'  P1G= ,0@X GM@  -:ʍ0 1Sp 3@  P3@ 00B] P@@0SH3^2G-0 P1 0P1 3\2G-0 P1  0P1\  0@PP2@-G G$P̍@ :AF _01@`"0yH2P2G01P1 32 0A*0[pP 1@Y pPp1P2G͍01P1 32 0A*0:pP␡T1@m8x W. 0@@Dd@ D` 4P $F- 0 ` Y @G`P 0@000CPT 00SD @@h0P2L0P-pdލڍ舐P`ȑ `ȒВؒ -LekuhUsage: udevmonitor [--environment] [--kernel] [--udev] [--help] --env print the whole event environment --kernel print kernel uevents --udev print udev events --help print this help text root privileges needed to subscribe to kernel events udevmonitor will print the received events for:/org/kernel/udev/monitorerror getting socket: %s bind failed: %s UDEV the event which udev sends out after rule processingerror receiving uevent message: %s %llu.%06uUEVENTerror receiving udev message: %s UDEV DEVPATHACTIONSUBSYSTEM%s[%s] %-8s %s (%s) UEVENT the kernel ueventenvironmentkerneludevhelp(e8k@uHhP4 ` xH؂ > ppppppppppppppppppppppppppAaeabi5TE udevmonitor'.shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  ؂p!HH>) 2 ;``6ppLAGxxMU_kw|t p/070701002EC7D0000081ED00000000000000000000000147CEEB5800004084000000080000001100000000000000000000001700000000usr/sbin/update-passwdELF((4<4 (444|:|:|:|:|::::Qtd/lib/ld-uClibc.so.0E0. (,%  -') #$*/+" & !(L!8* 'x6̈U@<?؈HHHRWL ^<F<e0lHxf 0,`v88|D07P \0T@<hH (P tX0 :<H`@<ȉ0<ԉ3<.@<$0`;,abortlibc.so.0strcpyputspentstrerrorgetopt_longulckpwdfputgrentfgetspentputsmallocoptarglchownfgetgrentchmodrenamefprintfumasklstatunlink__uClibc_mainfopenfclosefgetpwentstrcmpasprintfstderrfwrite__errno_locationexitstrlen__assert__data_startfree__exidx_start__exidx_end_edata__bss_start__bss_start____bss_end____end__< <%d;h;l;p;t;x;|; ; ; ; ;;;;;;;;;;;;;; ;!;#;$;&;);*;+;,;-;/ -L-̲Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ|Ə ʌtƏ ʌlƏ ʌdƏ ʌ\Ə ʌTƏ ʌLƏ ʌDƏ ʌ<Ə ʌ4Ə ʌ,Ə ʌ$Ə ʌƏ ʌƏ ʌ Ə ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌƏ ʌ  --- 0pHlGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGF 0S00/<-(M0 S R/Ѝ/: R 8Q448P00 00000 S44 /0\8 0408  0 4 /P/,0Q/, R/0P/0S\ S0/ /    0P/(@-(P $0@g @<@-7P $0@U .<ث@-< <0<@<< 0@M$@Ѝ;;;<<0@-MPP ,0@$ 0Ѝ0<@-`R MpP p p Ѝ@ 0@P x@ 0lp p$0@ 0<p@-M`PP 00@x 0Ѝp<A-MPXp`P `1@` 0HЍhvPpt dP @F 0k@&P 0@7 0\ ]`P* R pt >P P@ 0DB$@ 07<0H`0p@-P \M@ 0=^/ ` P`CЍp `  0#0<x<@-/`PpM 1= W,05 0+S P@   0PЍwPt@qnk 0(hذ(1p@- @`R'PP/$5Π Q0 tP0@TPp@[ p|Ph @M` sp<@B 00gp0<`8<@бh,1p@- @`R+`PP3LP0@T $\/0 k<P @W  0p>Pp|h@C` p<@8 00p0<`@X<Xx1p@- @`R' PP/$Ϡ Q0 P0@TPp@ p|h @` p<@ 00p0<`H< H2A-MQ4 RbЍ\WR ppQAc ` 1@TR A.@PG 1R@PA  R PAH pp1@T3 h@P* X5@P$ Q4A<   1u@T,  A@P 0@P y'n9 0Td@h@l t08 B{8@X<<0<,<x; <$<<<(<X@<8@0@-@PM (P0@T (PЍ0@-@PM`" p0@T , ̠0RcRPP , , R P 0HQ  , 0@00TЍ(,<<0<xO-@P M\ ԢԂ0@TV , 0RcR `P , ,R \0,  Q Pr  8,:PpW6 PP1,(PpW PP,PpWd PP 0S4P0@T ЍP\P P^P00W0! (P0P0W 0 (P P W0  (PP P U(0t0P( d (\P x0H(,e0PS 0<<<(08hȴдE-@MpTP` ,0cS0@TЍPPD <R0@?( ,0<<0<0@-@PMP0@T (PЍ00@-0040`MPVp8 R @(pP 0@T80P80408PЍ40@444PP0P0S8 8 PꨵE-@M`Tp0@T (P0@T lP ,P 0PU@Ѝ0P 440  ( \ ,0( &ꨵ<<0<@-@3PT -P 0 [b<-<M $ 8(,04Ѝ@-@P Q@E-`M 0@T p@pTW P 0 @PU Ѝ 1A- pR/`P0@ $R(  P+U0+PE,P,0 PPP @ 0tT<`P0@ 0 0<<80@-P@0M0ifЍ0 1A- pR+`P,G@0 ^ $0,( RPPP @= 0bpd-Lf`PuP 0@$ 0(I@0<<`x0@-P@MЍ01A- pR.)`P/@0 $ S(0 +Q0, ,0 GPP P @ 0tT<`P0@ 0 0<<ȶ0@-M@$QP,0( $ *Ѝ0Q ,@ (<0E-@RM`P P 0@TЍ,GPp 0 ,00\ ,0( [<<0<`E-cMP@ p#3pPpi G0@/SWTdpب"00  Ѝl"l0 T L2DŸ @"0S0RP 1A P!aP `P QdqP 1Pt l1& `1XH @1>4 ,1$1  0P@ R\tP} ?PYusZ\TQLPg P `0a<<4<;<;0<,<;8<<x<< <$<(<Hзط<< -LError unlocking files: %s Error locking files: %s update-passwd %s 3.5.3Usage: update-passwd [OPTION]... -p, --passwd-master=file Use file as the master account list -g, --group-master=file Use file as the master group list -P, --passwd=file Use file as the system passwd file -S, --shadow=file Use file as the system shadow file -G, --group=file Use file as the system group file -s, --sanity-check Only perform sanity-checks -v, --verbose Show details about what we are doing (recommended) -n, --dry-run Just say what we would do but do nothing -L, --no-locking Don't try to lock files -h, --help Display this information and exit -V, --version Show version number and exit File locations used: master passwd: %s master group : %s system passwd: %s system shadow: %s system group : %s Report bugs to the Debian bug tracking system, package "base-passwd". Error unlinking %s: %s Error unlinking old backupfile %s: %s Error making backupfile %s: %s Error: failed to replace %s with %s: %s Error renaming %s to %s: %s Error lstating %s: %s Error chmoding %s: %s Error lchowning %s: %s Replacing "%s" with "%s" %s%s.orgput_file_in_place: Not enough memory available passwd!=((void *)0)update-passwd.cf!=((void *)0)%s:%s:::%s:%s:%s %s:%s:%u:%u:%s:%s:%s Writing group-file to %s wtFailed to open group-file %s for writing: %s group->t==t_groupError writing group-entry: %s Error closing group-file: %s Writing passwd-file to %s Failed to open passwd-file %s for writing: %s passwd->t==t_passwdError writing passwd-entry: %s Error closing passwd-file: %s Writing shadow-file to %s Failed to open shadow-file %s for writing: %s shadow->t==t_shadowError writing shadow-entry: %s Error closing shadow-file: %s No changes neededWould commit %d changes %d changes have been made, rewriting files .upwd-writeNot enough memory available while committing passwd-file Not enough memory available while committing shadow-file Not enough memory available while committing group-file Changing gid of %s from %u to %u Changing uid of %s from %u to %u ABSENTChanging gid of %s from %u (%s) to %u (%s) Changing GECOS of %s from "%s" to "%s". (none)Changing home-directory of %s from %s to %s Changing shell of %s from %s to %s Removing %s "%s" (%u) +Moving %s "%s" (%u) to before "+" entry Out of memory! Reading group from %s rError opening group file %s: %s Error reading group file %s: %s Reading shadow from %s Error opening shadow file %s: %s Error reading shadow file %s: %s Reading passwd from %s Error opening passwd file %s: %s Error reading passwd file %s: %s Internal error: unexpected entrytype %d Adding %s "%s" (%u) Internal error: getopt_long returned unexpected value '%c' g:p:G:P:S:snvLhVgroupuser/usr/share/base-passwd/passwd.master/usr/share/base-passwd/group.master/etc/passwd/etc/shadow/etc/grouppasswd-mastergroup-masterpasswdshadowsanity-checkverbosedry-runhelpversion 11!#?$?%)FG?H?I?J?K?L? 00 #0$0F`ppgPSзGsvnhVwrite_groupwrite_shadowwrite_passwdfputpwent l p|:: h X;\L:||||||||||||||||||||||||||||||||||0@PAaeabi5TE update-passwdSH .shstrtab.interp.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.ARM.attributes.gnu_debuglink  !h) LL2 \\;ll6||A(( H!Gpp+M+Uxx:_|:|:k::w::|::X;X;;;<<8p<#<7<070701002EC95F0000A1FF00000000000000000000000147CEFADF00000011000000080000001100000000000000000000001000000000usr/sbin/chroot../../bin/busybox070701002EC77F000041ED00000000000000000000000347CEFADB00000000000000080000001100000000000000000000000800000000usr/lib070701002EC8D1000081ED00000000000000000000000147CEEB9A0001C1E8000000080000001100000000000000000000001900000000usr/lib/liblzo2.so.2.0.0ELF(4P4 (tttt;t;<<Qtd DBFteIQN^W94Y\7kl_rhV`#UgAp"PCZ(H=qx%@y G0cmv; 8Ruf,dz$o5[i{JLj6Ob)n*~s|+K!/2 XS< &?M 1-]:a'> 3w.E}T9;;8;d4b;l# D !$np\!t)(48D7p 5 pG8L(I;8p l=;$`8;_, HpP0$ p!$ "IGH4%N,|a8ܒP !a d=;;' p}88/!$!;o1,$T8e`$$L 4$M88(p8p p<!< 3$Bt)p;Xw888L!$o l=\T4;q;d<xhD 8,X!`;` !$ 4zDU d=@! |;tsu`d\/ { l=bX(8 ~ g<=; xSHP8;Iht!|;HP(,PN d=< l=%(!d.;x8nh=HB8A `=F@;; 5AH4m]MH!!TZ8h8e; _init_fini__cxa_finalize_Jv_RegisterClasseslzo_get_crc32_tablelzo_crc32_lzo_config_check__lzo_init_v2__lzo_init_done__lzo_ptr_linear__lzo_align_gaplzo_memsetlzo_memmovelzo_memcpylzo_memcmp__lzo_copyrightlzo_version_lzo_version_string_lzo_version_datelzo_adler32lzo1_infolzo1_decompresslzo1_compresslzo1_99_compress_lzo1b_store_runlzo1a_infolzo1a_decompresslzo1a_compresslzo1a_99_compresslzo1b_1_compress_lzo1b_do_compress_lzo1b_1_compress_funclzo1b_2_compress_lzo1b_2_compress_funclzo1b_3_compress_lzo1b_3_compress_funclzo1b_4_compress_lzo1b_4_compress_funclzo1b_5_compress_lzo1b_5_compress_funclzo1b_6_compress_lzo1b_6_compress_funclzo1b_7_compress_lzo1b_7_compress_funclzo1b_8_compress_lzo1b_8_compress_funclzo1b_9_compress_lzo1b_9_compress_funclzo1b_99_compress_lzo1b_99_compress_funclzo1b_999_compress_callbacklzo1b_999_compresslzo1b_decompresslzo1b_decompress_safe_lzo1b_get_compress_funclzo1b_compress_lzo1c_store_runlzo1c_1_compress_lzo1c_do_compress_lzo1c_1_compress_funclzo1c_2_compress_lzo1c_2_compress_funclzo1c_3_compress_lzo1c_3_compress_funclzo1c_4_compress_lzo1c_4_compress_funclzo1c_5_compress_lzo1c_5_compress_funclzo1c_6_compress_lzo1c_6_compress_funclzo1c_7_compress_lzo1c_7_compress_funclzo1c_8_compress_lzo1c_8_compress_funclzo1c_9_compress_lzo1c_9_compress_funclzo1c_99_compress_lzo1c_99_compress_funclzo1c_999_compress_callbacklzo1c_999_compresslzo1c_decompresslzo1c_decompress_safe_lzo1c_get_compress_funclzo1c_compresslzo1f_1_compresslzo1f_999_compress_callbacklzo1f_999_compresslzo1f_decompresslzo1f_decompress_safelzo1x_1_compresslzo1x_999_compress_internallzo1x_999_compress_levellzo1x_999_compresslzo1x_999_compress_dictlzo1x_decompresslzo1x_decompress_safelzo1x_decompress_dict_safelzo1x_optimizelzo1x_1_11_compresslzo1x_1_12_compresslzo1x_1_15_compresslzo1y_1_compresslzo1y_999_compress_internallzo1y_999_compress_levellzo1y_999_compresslzo1y_999_compress_dictlzo1y_decompresslzo1y_decompress_safelzo1y_decompress_dict_safelzo1y_optimizelzo1z_999_compress_internallzo1z_999_compress_levellzo1z_999_compresslzo1z_999_compress_dictlzo1z_decompresslzo1z_decompress_safelzo1z_decompress_dict_safelzo2a_999_compress_callbacklzo2a_999_compresslzo2a_decompresslzo2a_decompress_saferaiselibc.so.0__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__liblzo2.so.2t;x;;;;;;;;;;;;;;;;;;;;;`=;U;;,;i;;;+;;E;_;2;<M<< <L<n<P=!T=QX=}\=<< < === =$=%='=9=: =@$=A(=S,=Y0=[4=g8=k<=x@=zD=H=L= -L-$!Ə"ʌ$Ə"ʌƏ"ʌƏ"ʌ Ə"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌƏ"ʌ|Ə"ʌtGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGFD-DD@ 0MS00 R(0/00ЍD/|hxD-000  R 00S/D/\t- /wO-MQ h @Q`000p# aP$& '@!4 `(p@P#$,)1` "4#. ! p#$"0$1@ "4#P%P #!0`&  B@`@ ! 0!$"p'pS1"4# !#$"("4  , #$ ) 0" .!,$"# 1"# $@!,D" PЍ,  0, S0 $D,wM 0SЍ/pD-鬠 P  q |\~^ psSrRqQpPtTuUvVpDp/0@-M@P@deЍ0-0 /l /- /{- /d{- /@{- /{C-`Q\ ȠR,Ƞ `V 00Xp1p!WgW   R `<>8(2C"B0 X cb@P0 @ P0@P  0 @ P @0 P  @P0 pG W `qP00Q0 0/ RA-`p#**FV:@PDPDFoFF/ FFVF@*DV!00 F   R00@p`eXV@H *XV ` 0 R0K-PP!#*P`@PP8@P 30PF P ,0S Pp`PXiX P0ԅPFn0 P0 P `Q`` 0 R0`PK-QMp00Q \R `@F PF) @P0,!_@.R@9q`!0.",))1PU e X0 SX =?P"!PU e X R  @R P@1: gr   0k0Ѝ  k\0ST@`  gRg   ^ppp\ pGHd0@" 00S0S 0pRp\ 0pRp\ 0 pR g\BP 0S  \pPH -d=  @00n@-@QMp`P@ TЍ@  fTp#p3ЍK-@M '` 0@ |"_`r `!1P`.  V@0 P' D偂#埜_ `t?@p 0R ^ Q a \^`Ya87 `\@Vu(.0 0R 0R 0$R$0 0<$R< (  fBY 51: 00 Q00S V peWr p@\PY `" @ID 2 0B@QP_U` E(,2yRPV@Uu( @fQV* `0R@0d  `\@T` B = 0  e B2\0 <P_U`p%(,2კIRPU:@Uu( WFW*   0G 0@\  P@ R  d  0l0@ЍPP@(0 00(00,00S@,0 00,00000R600 00000400R,40 00400800R"80 0R R00Y0S  P00Q0 0/ RA-1`P1/: R1P1:@PpDpDiF) I VY@*DyHXp V @ :00@HX`gPpFV:@pDpDFoFF/FFVF_@*DV 0 F    R V `  0 R0K-pPP!#*P@`P@`P 0PF Pd@PWiW 0 R0PW@`P\P \DP2 cW `00  \@PP0D"Pb b  @\@@0 00@P@@P,0S PK-Q Mp 0@| \r N) NC0`P,&_@%` @Yp9`q`!P.",Y)1P0US:TQ  [O0 Sa =?P"1P RCTA  [? R<\9 R6T@ 0cQ `gVF `00\pp@p0SH pGKd0@"0    a ЍX@P@1: gr   0b00S0SFV[* F \``@ p R0pS p R0pS  p R g\BW * QpW* 0 S K -d=  @00\@L  e _@-@QMp`P@ TЍ@  ?fTp#p3ЍK-@M@ '` 0& l㉂"_Pb '0Ƞ` N, AP Up&0b' 0_`D?wp @  0R @T Q a \@TPXQ;: P\UpE&b'0@@ 0R 0R0 0$000R$0 0<$R< (  eBX 11:00 [00S U U pnWm p @\@ @XP KH " 0B@S|_^u&`b!2IɠU^ &b @ePU*k0 R@0d  P\@TPK =   n B2\0HL_p^E&`pb!"ɠᬉ^:^ &b VFW* 0 G  @\ Y I00  z@Q  d  0a0@Ѝ@(0 00(00,00S7,0 00,00000R-00 00000400R#40 00400800R80 0R [XQ  K- M@ (@@00 C@ p` (!2'&@0Y%)P0U:T [* [.0 S+ * 0@P!P RT@Q@ \  l }  0`0 Ѝ[* [0 S\@0 R@ 0S @ @Q@p T Tz `lV `  Q0@ 0@ R! N [ n  K@2 0 0  0 SK@i @ +4 0 0S  R0S  R0S@T  Q@T  P @a"T9 0D  0+$ Q Q @P@00@  FV*  F  00 Q@ @u  @ n "D Q D D0@  00 P0C"BAꁀD-$M UЍ|K- M@ (@ @0s 0 C@ p` (!2'&@0Y%)P0U:T [* [-0 S* * 0@P!P RT@Q@@ T d6b Ѝ[* [0 S\@0 R@P0S @ @Qp@Tp T `nV`  Q0  R2 P@N [e!K@ 2 000PPpc(!" @2,@`r@Y%Y @  +0@0S\ @R0P@ T R Q @T 0 S  @b"\OPL PP0+$S >P@!p`3&")@,By@'i0\  L@@hFV* F 00 Q@@P D@I"L 0Q0D L0@ 0  P0"BLꁀD-$M ЍK- M@ (@ @0 0 C@ p c(!2'".@0`Y%)P0U:T [* [-0 S* * 0@P!P RT@Q@@ 0T  d@ n Ѝ[* [0 S\@0^@  R @0@Qp@Tp `T `aV`  Q`` `RA 0@F [`c0K@2"0 P pP%"(@B!!p@R)0@P#!!r$@凒%@  9#J @ 0+@0`S\ R0@S\ ^  Q @`T 0 S @n"\FL  0+Ġ^6 @pP%"(`0 P0@@@bFV*0 F 00 Q@@J @C`"L 0Q0D >LC 0 P .NLꁀD-$M uЍL K-@M@ (` 00 lr"_Pb ! `p K)AP U0&pဒ#,_@`#aȠ@,`P `^* 0R Q T`P+ 0PS U@)$`aL Q + `U U @gT@ Q p V'  P@ F2  0\`\0,)_p# ` )BPip&0`PB)+ℒ&\ 0cPP Pn0 SPUg"\0L 00Ȕ"L Q <#L0@0  P (HL !40X\,5)_p  `)b@p!9 @+b)$; 0RM 0RH 0$RA$0 0<$R< (R eBT@1 5/FT?* D00 QpH  \00PS!^  nu0 c@ЍF  0#0\8p0XH SpPRp(0 00(00,00S,0 00,00000R00 00000400R40 00400800R80 0R |ꁀD-$M ЍK- M (@ 0\(_`R! "B0@+ @` V0 E%ㄲ#_P@ %@8#@PP `^* 0R @TQ@1 ` `Q VPE+% d@Lp$ap @V pV  PhU P QTp<  RB0 D  \ P`+&_Pb!%2)@"Y@ 0T0P &"#_P!R @ 9A PB+`ᄲ%w \0nS g`0 S`Vh"\0L 00ɔ "L Q $#L0@ 0  P )IL!40YP\+_0!#"ɠ@,9@ .T ̠5!_"PPP.R9@#ɠ A@R+$ 0R" 0R 0pR 0RpR 0fCQ15 FU?* p E  00 Q& \`Q ^ n c ЍD 00.\0YI  `D0 0pS 0pR 0pR 0pR 0R ꁀD-$M 3ЍtK-@M`@ ( 0Ppl"'_b!%2 N)yA XP0& b%0_ "Q0P pP `^* 0R PUQp!   Q0XPu&b%0eL p,p pX X PdU P Q0@0W&  Q0A 0 G"  0 R@_T 5&b" yYA@PPT&b,^  l0Rh 0SXd"\0L 00ɔ "L Q $L0@ 0  P )IL !40Y@Pp&l@'_ r!P" 9 #ɠ 0U  '|""_0p #09'#9@Q`PV<%"R!_ @"2 9#)a0\ %_`"&R9#)`pR&b' 0R 0R 0$R$0 0<$R< (S hBQ1 5FU@*  E  Q@  \Q ^  n  0l0@Ѝ0G  .Ġ R @Y  I  @!@(0 00(00,00S,0 00,00000R00 00000400R40 00400800R80 0R {ꁀD-$M hЍ K- M (@ 0\(_`R! A0@+ @` V0 E%ㄲ#_P@ @8#@PP `^* 0Rt @T@T1`  `RVPE+% dL@p ap @V pV PhU P Q  TpZ  RB D2 0" \P`+_0b!!P@(9@ 0T &_0b"PQ @0! A PB+`ᄲ%t 0R 0R 0pR{ 0Rp 0fCQ15m \0 cR g` R`Vh"\0L 00ɔ "L 0Q0"L0@ 0  P )IL!40YuPE+㄂!_0P!@9#)0@ ̠U0@(_"#@@A9@#ɠ Q@R+$FU?*  pE p00 Q$ \  `R ^ n< b ЍD 0#0\Y00I  ``0 0pS= 0pR8 0pR3 0pR. 0R (ꁀD-$M ЍL%K-@ M (@0 \r._R! a0@ @.y A`[0pE% b# _ @P@Ƞ,8@PP `^* 0Ra @T Q@1 ?  PB[PE&b%d!L@ @[  [i PgUP00 QpTE Q(A D0 0 Q%p_PW&@Pb! :#JrpP@W&b, 0R 0R 0R 0R* 0kCQ15 \ b0^ 0` ^[ g"\  L 0!$ S X< %&_ₒ! qP)@"i0@pT l)_0r" (9@PA0U',!_@⤁0)@"IQ`0V !\""_  9@#Yap0WlU"_!!P9# @0 q@X @!<""_ PPpp@.9@Y<"_ B!`9@#)0V ̠$_"@A0 p!) a`PB&b%FU^* E 00 Qp Q P ^ nN c Ѝ D  0#0Qp"L 0Q0!L0@ 0  P0"BL Q  A00  p p0 S 0R 0R 0R 0RY ꁀD-$M Ѝ,K-@M@ (` 0 |㉂"_Pr 0ɠ` N, AP U`'0r& 0,_`0h &Ƞ ` Q a\* 0RT ^X Q PPU`'r&0P [U U `dV ` Q@ XQ [KH " 2 0Q\@_`TU'``r! 2.B@PTP'r, 0R 0R0 0$000R$0 0<$R< (  eBX 11:00 [00S |\~k0Sy `P ^PUd"\0L 00ɔ "L 0Q0"L0@ 0  P )IL0+SXl@_T`5'`r&  *"B@T: T'r D 0?  +0R0-@$0@P @  @00FV*p0 F0p  \@ @p @i"D Q D D0@ 00 P0C"BAꁀD-$M Ѝ$VK-(M  0P 0`M F? `$ @P0 p` (!2'& 0"HY%)PU:T 0[ [/0 S, * 0HP!P RT@Q@@T  d@Pd(Ѝ0[ [ R\HP0SH  R HP@Q@T T `aV$ VP^$`@ R @00 @\3 P@N [e K@0RP 00Q!0 S#@r b)BH`y@' M @ P ?0 +0 $ @0S R@ T0P  R@T Q@T  P P@e"\K L 00 0?P P +àR9P!`0 p#B 儒'$ 0P @@@kFV*p Fp00\@  @S @L"L PQPDPL0@ 0  PP"BLꁀD-$M |ЍH[K-(M  0 0PM E? P$ @0 p c(!P'2.H 0)`")PU:T 0[ [.0 S+ * 0HP!P RT@Q@@T  d@0n0(Ѝ0[ [ R\H^H 0S H @Q@T `T  `bV$ VQ0P03`0@0 R0 `  ``\B 0@F [`c/K @2  0P! pP 3%@僒!H@剂 P!9q )!0"(H.By@' Q@@ ? + 0$@0`S R\0@S RP  Q@`T P @a"\_L 00?0 0 +àRN P@p)!。$H@2' `$ ! Qp 3'!"Hp.BY@%0P 0@@@HFV*p Fp00\ @ @0 @)`"L Q DL N 00 P0"BLꁀD-$M ЍaK-0Mp埜P@_%$ +P P PqU A E)ℒ( 0 @<_P x'8 R`U  V*p0W \ q^P+pp 0PSU %)!l@ Q$`+ pU U `hV  V T0\`30L R@W'$ P@ G2 $0@Q\,)_P2 P ' P 0p)+⎒ \$0`PSpPn \PUh"\0L 00Ĕ"L 0Q0#L0@@0  P $DL$0?  @!àT@\0,u)_# @!yP')0p)+⎒'2FVb*0 F @00\@h$ PK0PS< ^  n@ n0Ѝ G $0?pp$p@' @QU T00D80pS 0pR 0p(pR 0p(R,  eB^1$`5 o@PO,0 p,0pp0S 0pR 0pR 0pR0pS ꁀD-$M VЍ谑4hK-(M@埜`_&. H(R` P IQ`V E) H 0 0$  0$ _ H)P("8@T@V  T*P0U, \ @^Q$`  0`S V$ .$ l @ @p, a p V pV PkU  U X0\P30L R  Y p?  QPA P @I 0 RP$ %,+_0₲! #R`)@"9H PT 0 U+"_ 0!2 YH%)A0`R#ᅒ,$j@T 0 PcUg`@ R`Vk"\0L 00Ȕ"L PQP  0pP`XP(PUW~`!  PPP`P f X  \ 0TD C 0 ^@"Bꁀ0@-Q MP@ ^ 0 R0 e 000 Ѝ0dP 0@-R@@P@T P00@ 0 R00R B0Q@G_B@ 0ES 00 P0"0GB@ꁀK-S MPE @c@,` X _0` 0@ P\ *P` , H`Dp@ L0@@@T@PpDDppW`HpH`[C:TpH`WpGTp0\]^@厒,r( $ 8NDp0@\]^$@",0!#" 80X X ʌXX@p:$XH@$@00Dpl_]\`^ʠ")XB( #ᇰ࠘0X⼀ᴐ JX @X ᴐ@^$0p(`T0l:S0C(00*Xp pT0H S0CT0\ ]^`|2 _& '"`8X` pG`@$0 p\ p8*0@p`P\:LD`pW@p0p@0W0DpD0H0(`V0H`H0P$00 0000 , 0bP0 \  800QJ Ѝ$ R B@$ @Q0\`X ) 0 *XX0  0S\ 0R' 0 *XX0@`V*0 WL g l l  Xp@c,00p0`0`)4 0UF H`QD2!0 pp`p` 0 ` PlULV0  PPD 0 aP L  \ 0H *ZW0PpWd:.:ZPPD  RB4  Y pb\ b4 Q1p0 0R  ?4 0P\ TPP @` R E P00 h]0S  v   00`p`00i0\ (Ѝ E0 h2X L;K-0MP @ 0$, (p`P!"&@%2** ^ :0\0  S*0 S0S "[ \  X* XR R $Q@PU0S(@\ PdUR,X@@H,@( 0 R0,(@,( P@RC  D(@ R d @# X Bp,@ ,H ! .,(@,Pd@P Pl0Ѝ0 SB0!@R, P,0P,P$T*(@hUF, 0E0, 0@S@XP @R0@S @X X P R  @P 0 S 0( Sn,!PCJ,P@ ,, @Y,,0EQ NE0DC,@ 0 T R(0H@,0M0 PC9,S000, @ 0PX0@Q#0\P" 0BQ, !@0, ꁀA- QM`Ppࠑ@ 0@T T^00d 0 R00@ e00ЍTT0D0Δ DRX D0@ 0 P B.N L ^NꁀK-0MP @ 0$, (p`P!"&@%2*"* ^ :0\0  S*0 S0S "[ \  X* XR R $Q@PU0S(@\ PdUR,X@@H,@( 0 R0,(@,( P@RC  D(@ R d @# X Bp,@ ,H ! .,(@,Pd@P Pl0Ѝ0 SB0!@R, P,0P,P$T*(@hUF, 0E0, 0@S@XP @R0@S @X X P R  @P 0 S 0( Sn,!PCJ,P@ ,, @Y,,0EQ NE0DC,@ 0 T R(0H@,0M0 PC9,S000, @ 0PX0@Q#0\P" 0BQ, !@0, ꁀA- QM`Ppࠑ@ 0@T T^00d 0 R00@ e00ЍTT0D0Δ DRX D0@ 0 P B.N L ^NꁀK- M @  D @0 @p`(!P2'&@0P(( 0^:\  Y* Y0S * 0@! R \  Y* YP@T@0 Q@ 0d@l0 Ѝ R@@0S@\ @dTC \L 0 R0P @PR4 EP Y e P Y`@@ I @! .300S@I!@2 00@@U*PhTB0D00PS P@ R0S P@T 0R P^ \  Ya0!PI8@ @ 00@ I@50 0DQ!D0LÁ P0 \ B%0E@0`@@; PI0@Iŀs !@P \ @A 3$0@P0 ] Q000 @ ꁀA- QM`Ppࠑ@ 0@T T^00d 0 R00@ e00ЍTT0D0Δ DRX D0@ 0 P B.N L ^NꁀK- M  0 0A0 @p`S(@0'"&Pɠ,) 0P:Q  [* [0S *:ʠ@0, R Q  [* [P@T@@  \@0 d@l Ѝ R@0S@Q d^C@QPPA 0 R0P@@ 0PR4 EP [ e P [x@@ K 10.# 0S@K!2 $0@U*Pj^[ 0N0 P\@0S Q@ T 0S \@ R 0S @ T Q0 S0S R PP ^ @ [d !PKK @ 00 PK!0@)0N@Q@ N0LÁ P0 \ %0NED0GIT000 @ P d0@A#00\@" K@ @!@@ ꁀA-QM`Ppࠑ@ 0@T T^00d 0 R00@ e00ЍTT0D0Δ DRX D0@ 0 P B.N L ^Nꁀp@-@@R@@S R SC0 12! 0\0\0@p SRLQ +CB0!!10 X0 X  T9 ^YD0N)000 N0R0H!BoN0Fc 0  P0"B/B % 10d0@dp C1" 0T@0T0p!^0N 0PD0! N 0R0l nN0Fc 0  P0".B % 10`0@`p聀(p@-<`S\P@0<``0 T$T)DQ` D0@ 0 P0C"BNp p  Rp^00Nh h 0D0l l ꁀ0@-PSM@LPPP Ѝ0LP0P0P+P P Q" QPR Q#!P!@Q.@0B# R/R/ Q00R0S R//// Q* P @\$B@0A P/၀00@-S ^S@CQ,\ ^ SSCA,\C ,0S  S,000 \@,000"S \,0K-S0M` G  cZ(  @P  Pl!*`q XqTP\!\PPXTTYpXXq0Ks0U d1XqS0Cd1@0mln,)_!  $%@8OZOPര WNT _mlQnA0.ര$ 0"2$0H(X 0 T@.̂O hZP0Z0ᰐPZ@0@Pᴐ:$PUEP$P( 0@RP0P TL_mQlAGʠPnq2%Z_⃲' !"8ቀx0 hpᴰ 0ZW0^pP$崐(@ UP|:[.z0Z/(0 dXAQAd0mlnq,._'#"p㇈G 8OZ0Z pBTᰀ0mql@$O P$Zp 屐^ 7*P Pl:\TqXY0PP1Y0p( TT1W0XqX1R$0000000,aP \ 080Qr0Ѝ$YIP$PO*ZȠ@ 0LR6 ^00UP P[)[O , 0W X$0 *ZW0  0S\, 0R> *ZW0PpWd:.:ZPPD  RB4  Y pb\ b4 Q1p0 0R  O4 0P\ TPP @` R E P00 h]0S  ↨   00`p`00i0\ (Ѝ E0 h2X \;p@-@@R@@PJ R4 U^L R UM ^iE0N %000Ĕ N0Q0!BN0@ 0  P0"BB &30d0Pdp SHSH CB!#2 0\0P\pC !30TP0T0p!^0N 00Ĕ`E!N 0Q0 N0@ 0  P0"B &30`0P`p S| N00,E0B #X0PXp聀(p@-<`S\P@0<``0 T$T)DQ` D0@ 0 P0C"BNp p  Rp^00Nh h 0D0l l ꁀ0@-PSM@LPPP Ѝ0LP0P0P+P P Q" QPR Q#!P!@Q.@0B# R/R/ Q00R0S R//// Q* P @\$B@0A P/၀p@-\`0 ^# 0LS ^ \" ^ \ \' "\0L, R  R0,00pR @LQ,0R@,p\0LS LA,0S  S ,pL0S  SL pK-S0M` G  cZ,  @P  Pl!*`q XqTP\!\PPXTTYpXXq0Ks0V d1XqS0Cd1@Pmln1,+_# )PH O 8ZOരP WN  T _mlQnA0.ര$ 0"2$0H(X 0 T̂.@0hZ000O Z@ZP@ᰐᴐ:$PUEP$P, 0@RP0P>TL_0mlAGʠpnQ儲'Z"% !8ተX h P 0Z U 0^Pp$崐(@Wp}:X.*0Z(0 dXA\Ldmln1,._ #Č# O8ZG Z0 T B 0ml!@$Oʠp$Z? p峐^ p8* PpPl:\Tq YP0P1 Y0TT1X1(p W0XqX1Q$0 000000 ,bP \  800Q0Ѝ$YIP$P OʠZH 0DRh 0S00Wp pXT[ Q@U$(@K $0@ TR  JZ U0: @ T$0R 0R0@S @R@(0S 0@S  k!R@T00W*Rp  W * .JZ?W0S$p^* Y\! i l l @.:ZQp  RB4  Y 0b\ᖕ b4\p0 0R  "4 0p @ lP0S40#`U  V R eR0 @0PC p@ 1%E`U A`@fY K-M4`\08p   9`CY 0CL \` PYL^` Pv 0e^ fPh: 0^0^ 00` Rࠁ8?^@T ܔC@ b"F  ` @0eS:0gQQa*  RP^` eP `mC"A0gTd @ PV V0g #0%*^^l Q  0f ?ACRZPgЍ 0g^70 f0LR: P AP A ^ `eV`3L"A0gT0dcY~:X0h џh   PP @g^I R0 Rl 09S0 eR: 0lP: 0 @`P\@PP cY-:Th, ၟhPP\PO` C0& `  Q0^ @Rl@0 SS0S TP* 0 `#3Q` 0g0P: 7 @00PcY:0Xh @P hPP PLK-S(M`r ,@c  0 X @ 0@@  P\ *Pp ,HpD@L 0R@ @SD0DYpHHpH{S TPHpUPETPP]\^@<._ $ D)X  X8 WBD埌_@]\P^ 2,.. H $0( @ T͂XX00 0  X@XP@ᰐᴐ:$PUE@$@P 0@0D\_]0\Pʠ0^pX("' $2㋈ተx0 p JX@   W@ ^p$崐(PT}:X(0Xp(0p THPP@T]\^0._ r# Č+0z㠸X0pX  BU   ]p\0 @$ X0 p峐^ p8*0@pP\:L DpHY0@@0Y0(pDD0W0HpH0[$0000000,cP \ 080QQ(Ѝ$YI@$@X0P K R1 @X0 @)\P $0W S  XW0  [\$ 0R"  XW0@pW@:0ȃX@Jp,00004 0jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-2.02Oct 17 20052.02            xd=B4HN\T[4bhqw|THHHl   t;x;$ <ho<`=Aaeabi5TE liblzo2.so.2.0.05TEI@u.shstrtab.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.ARM.attributes.gnu_debuglink p $$ ! h* 3.(9ܗ?EȴȴMppWt;tcx;xo|;|t;<<x`=`d=dpd070701002EC8DB0000A1FF00000000000000000000000147CEFADB00000010000000080000001100000000000000000000001500000000usr/lib/liblzo2.so.2liblzo2.so.2.0.0070701002EC8DD000081ED00000000000000000000000147CEEB6F00010BCC000000080000001100000000000000000000001600000000usr/lib/libz.so.1.2.3ELF(p444 (PPPQtdpoS)E3G'h?AJc\^aC!<g#ZBmF+f&eKYlT;Hd7 i>2@L*U O(,_`1MbNn-.]= PjV:"4XR[9DW0$6  %8/5 QIk(@x9pD,0pgTE %tv:Ht5(8~%9p94 $&4X8:4`Px \@& 0D$ 5x",L QL@Dx4 4<e<L}D`&(K]P0Za0*TP( x] L_PQL,x 3/4XdFP+0 ^@5 )9`cDx P]Xv4il:PP# EL6*\H$kP(( ?14$>`*Bp M+0%H>L,Pp/ 2$b4 PB8``T+1 +d t0D*lo0;zT$ܸPt,y ,_fini__cxa_finalize_Jv_RegisterClassesadler32adler32_combinecompressBoundcompress2deflateInit_deflatedeflateEndget_crc_tablecrc32crc32_combinegzungetcgzeofgzdirectgzclearerrgzerrorstrlenmallocstrcpystrcat__errno_locationstrerrorz_errmsgfwritefputc__fputc_unlockedfcloseinflateEndgzclosegzwritegzputsgzputcgzrewindfseekinflateResetgzflushfflushgzprintfvsnprintffreadferrorgzreadinflatememcpygzseekmemsetgztellgzgetsgzgetcgzsetparamsdeflateParamsinflateInit2_fdopenftelldeflateInit2_fprintffopengzdopensprintfgzopenuncompressinflateInit_deflateSetHeaderdeflatePrimedeflateTunedeflateCopydeflateSetDictionary_tr_stored_block_tr_align_tr_flush_block_length_code_dist_codedeflateBounddeflateReset_tr_initzcfreezcallocdeflate_copyright_tr_tallyzlibVersionzlibCompileFlagszErrorinflatePrimeinflateGetHeaderinflateSyncinflateSyncPointinflateCopyinflateSetDictionaryinflate_tableinflate_fastinflateBackInit_inflateBackEndinflateBackinflate_copyrightlibc.so.0__exidx_start__exidx_end__data_start_edata__bss_start__bss_start____bss_end____end__libz.so.1ĄЄ܄ $(,048<@DHL $(<,=KLe,04 8 <@DHLPT$X&\(`)d*h+l.p2t3x4|68;<>@BCEGHIOQRSV[Ć\Ȇ^̆aІbԆd؆f܆ikmno -L-rƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌGFGFGFGF GF(GF0GF8GF@GFHGFPGFXGF`GFhGFpGFD-DD@ 0MS00 R(0/00ЍD/`o,D-000  R 00S/D/oC-R. H Q RRV=/RgVIV0Ip`P0 P @0P@ P 0  @ P0  P @ 0P@ 0pW@`$"V͠/47("B@ V0 Yb@c0YR   Y@^NN8C lY30  0@ 0@  0 @  @ 0  @ 0@I Y@Y  Y@p0'Ƞ2ALl@a̠ P @@0S.B BR,B Bpq 0 #/pD-頠- MC Ѝ- /i?E-鸧Q M pS 00 RP $̠<$ W  ~ \7y  pW " 1*,NW7P@ pGW .à .̠.7 +  0; !!,W 6 pW <"!: " Ġ< ,Ă  ЍW  4 pW0(  ,W5@0pGW0 #/#Ǡ/ #<̞  ,",W %0Q 0! "WNTE`2 ""Ǡ"0 ! 0*0ˌ #, "0!##Ǡ#  1  : ˌ0",0# !""Ǡ"0 ! 0*0ˌ 0##"0,##Ǡ#  1  : ˌ0 ""# ,""Ǡ"0 ! 0*0ˌ 0##"0,##Ǡ#  1  : ˌ0 ""# ,""Ǡ"0 ! 0*0ˌ #0, #.à .̠.7 + 0ˌ;  pG0 #W FWP`4 ""Ǡ? <",# !0,0###Ǡ/ ,#<"0! , """Ǡ? <", 0#0# !0###Ǡ/ ,#< " " 0! """Ǡ? <",0#0# !0###Ǡ/ ,#< " " 0! """Ǡ? <", #0" !0##/#Ǡ/ #<̞  pG ,"W, m~i?Q  0 "/p@-`P@@TpC-PRAM`* 0  0| 0 S p   @   EQ   @`  `&Aߍ` Q/\ p00rR\l0s8 h0lR  R0Ch0p 8</P \0rS /< Q8\  /P \0rSX//P/8Q0800<0@pD-PPM = 80S0- s`- V @T`80caPP @TXPP T>P@:0A  0P^PЍpH.`$  0_j@-@PM`Ѝ\0wSw0C0pYqW)h hh0U8ahp8pQ8 p8 Rp RRBH @0OUH 8 8p@-@P`H0S   RP4 5*`V%Tp*Op@-@P`# PP C0S \0wS$ rS P@P P8`DV`P -HP )TP %#pQP P P@-@P \0wS @bP@L@dp@-@P`Pp\0wS ^) \H@0  Ph d00 d0hMd0h Pn adh 8 L nLlp80@-PM@ Ѝ0@- M0c P Ѝ0@-@PMЍ0\0PrS Dl8P_pD-L@H4M PP` 0 .04ЍpL_ &pD-鬠`P/ R 0S/P@-ZM\<@8 010C00P-P 0 |0 -! 000@-@PMЍ0Q P*UEU IU[U(0S ($D0S ($@0S ($80S ($($qUgUqU 0UK-P,l 8pAo@@F0RM@ |x`0 `A/ 0R@V t04.!\! 0 RV*^T   R0 S0R 0R 0R@  0R' 0R" 0R 0R 0R 0R 0R  0 @R0 S 0lc0LBV@DpS`Y``P!Ѝ0@-80l P@P;0Q7 0R& 0R! 0R 0R 0R 0R  0R 0R^`aPt0pPP!00C-PQM@```ЍPU [-( pPX [-p , @( ,8 ( L@ ( ZD (  8P3 @0S0 D R- X+ ,8 , @@ LDD   @0%Z= `&M·$0@ P0ˇ+$K-`0@- 0MPS@1@! T   d0 0 d0Q000Ѝ0K-,ptM P0 <@`Vl 8X #t*X   h` 0S^ Sb   n0t ^t l08 XT H00# HA ^8 Q4 ,0`l<AOF0DkYi:8 @\p@lLD0g g gp \0l q`0gȠW,hP`@@` q@g8W#ȠP@`VЍ0 .00 10K-@P`PpQW 0S S4 S 0 0U),8AI@HU0d@` 8Pl@\@XTH 4@`"D H@D 0 ;#  0H0 T*0*SO-霪@PM PЍ`Q00V0SQ PQ QK U0\pp WDP *\(@(P E\N I\ [\ g\ ^ URY?Q Rt0SU5 ?Q1 p ,p@W?00PPppP( R )P Us  0YU P Yy0SӂSC0  0,400 ( 300   40,0  \0\ls3PRP [0 0Q#l ƠL7R qn 0" lP 0! 0B0SS@SRN & P  0p Wp  p^,0S \ l*00 ^p,P \:W[ p$P  0$ p Wp  p^,0S \ l: ^p ,P \:Wg, Rq 0Sm0  00 #4 0 mq 0 P 1 P :  00  1S ^,P \ l%:j ^ ,P \* l020 0 SI > mm000.00s0  PT[  NgzT0 l009 00  N }00Pf  ,0$R  \ S00PQ000 0#0#( 00  R  Pa  0S 00 ,40,^< E 0 l0~0I   0   R  0S qLD0pC Lm0 G0RʙR@BE-PM @PЍ`V q@0 T00?Uʐp  !0 S 0ST  0  |@Pp5O-霥Mt AO@[[ll8HX `T0D &4@`ᾰ@ 0ᰰ徐H```p@\d@x`` V*, lAK0NP @BT ``0Sll R S x@T` T:ltd@D@Zp 0aZm C $P`P !x0pt ` @G0p!ȠPG\㴐 P & 0Z] ``tx`p  0fl`Ftx` pF Q`l P:80H@X 0TD #4 0 @  H0 徐Wxp@ \`hplS\^80 n0l0\0Z QV tAO@[Art [RJ [8hQz\l P80  `\00l\4 R` 0S,h@T+ 8`Z Z 0  `S$ @0 㴰`0ⴰZ L Y l0t@ltQЍt @Bhl@t P+J\lY80 i0l \ R0P`p ` Q`Q 8`l0Z Z͠`Q@$0@!༰`@0hl4O-xMtp AO@^^lPlP8@HXT`D0!4 @`@0PH R ,A?@l`CQ B^ 'lP``@T@Dp @ZZ= $` aP`,0 ! @P A0!Ƞ \ 3P 0&  Z]Z= P `tP0B\`P t^XH8lPTD@4@`@`P0lP @0!"  0P HP `PlP \l \\80l0 l0l\ Ro tAO@^Yt ^Rc ^P\l P80 `\00l\ QH QH8Zm Z=`$@ @P0  ` PZ-P0tlP CNR ltlP80P`0lP XH0T #HX ˎ1NR$Q"lP`0S Ѝ4/ p@-@ PB0UX`PEt0S7l\ Rtl  PQ80`00 atl0l \ c0Q l \,0 aACNR:Q800l\L Qpgt0 s 3VS R \l \80 lV00l\,0PVpVp0 0? P"à  R 0P /PQpD-DPPM Ѝp`V 0S $P @,@ R b Rq0*0R0*  @0(@L ,D0 N<0@A d 0 0 |`0H@l@\@t@x0h@ (O- M8P\ `p04<  Ѝ08R1SP 0S $\~ v`WpgW 0 pG0IQUWWP Væ?[00ë/ ([- W p@P@ >PL0C|1 T@ 04X 0p, @( ,8 ( L@ ( Z}pD(  8P ! @P D R \  Z 0 $00$P`到 ЍOP0 $ |(0@ t40/YX'@-@M 0 0ЍG0@-0  R 0&- 0 PxRPNx B @ LRZPI> , 0(0PP@@@ @0D-Z-N 04@d0`0&m P8p`< ` +<0< P$ˀ [,ˀ08+`Dp#K-Q}@0\;M\p041Q-  0 Q0^\ 1 ^  P\k\[!0S: \ 1Q:0  R\Ѝ0 0P K-p@1Q`P`PRB+  !> ` PPQ `P Q `P `PX 1\Q \^ R !>`PPP \+-Ӳ0ѻ000²0ѻ0K-M 0PSRZM 8` `  `@T100 SA THZ  p᧎`<8p0.8#(  0#$ 0`Vc\Π @B @ :@ d^ʴ`V N@*^ @ ` V@ @ 0^  [n \% ~ Zm("800 0"0 a\ 0@0D@^! 43Z< pn\@`ڹpl8`#(  8 D@p# gQb@@@`KX0Zm3pӗqӅ<`!0@d ^zڱ >!8000!$ 0n\ @B@@^q "Zm<`pn\@a\ڹ 8#Ƞp0Ƞ'$ p,gQ@0D0Z= @ 幀PO:`Z<{`@ fTAZ 8 4(@"800 "400 c^LZ=4 ЍṀT0pᲀ  N@0  n`p l`p _Z80  ăXdggLhhK-PMQ͠ p _ `0@X00 p,04Q @,P 0R,  !\PX,@!,@1PZ \˃(PQM0Z PAW0,P 00b0Q- Y0@,P0U@,@T  @TQ-Q] 0Qp(0  `K1\˓B `ˆ  P`˖Q N B1\K\ˁ Q- 00@(@ QP0  2 .X( PP `{o p\Q P`pE 1p\ @p$ P  0 P RPQ0\ː !P ^Z͠N,P/ @ P$P 0  W0 000U 0P0U0e0PQ  #\ 0  0" ^@PUP G^N@PQ 0> p B0Q  >.0A0@P BWO@" ΁0S Z](P@\;$@D!Q0LSc0 !!p\Y p I. 00 08\#, R` R PPQ @8#H00Q P B@ ^PЍ@-Zm<`0Z]8PS@p Z͠S8 0 0"0C00 0 4 0ppG-Zm<`@آP T Z͠8⼐p @!800  0bW BhK Zm㼀<`@ph0LTdZ 8 4Ƞ@,8000,$ 0a^0 C Zm04@<`@ dp; TPZ͠80@("8000 $ @@`^ @ Zm<`@W@Z 8 + 4@!8000!$ 0c^ L IZ=4 Z80  d`Z8p 0|Z80$Zm<`@ WZ8 ; 40@ XbZ<000@-SZ]8P@  0 # Z=8< 0Z͠S8 0  A-Z}Z͠80.8#(  0#$  0bQ BZ=4 P("<04"#,U   0 U0Z=8 O-`lMP pP0@2R>+X&(+S@1 \@DTZ͠( Z=, . 0 Q !Q 3 #W R0QS Z]U/-0`  /5P- RS΂ 90000L  (,08<lPP0@-0^ Q<@P U 18 C 0$L1$@ RX ($0D H@ (4!@P 0S9 ^l Pd@0 d@>HHQ U *X ( H0PQ(  1C 9@Pa@@@X P L A0@U*X (H  A(0PP@8( 0 L 03@@ A< 08S@X (0< @H@ 4(0 1 P@8 T@P`988@P`9$ D@H HQD  U *X (H0PQ( L 09DPa D ,040 0aR 0 Rj 4D0 bR*0b@\(04 4 `0l0l\0 000 ,\!0ll@00 0 R0@, Q ,P@ @0S 0@X01S@1T0 ( ,(0@0 ,0d( d d0, @h\^*HX ( H0( PU 0 Q7h婑PE^ D ^hS.0L T0l T/Np l0@*P xLPU9 X (H0PU(8 (C"()! R 0^ \X (H0(PU R 3  & @X@1@!T 0S P  n0 S0 0b( X  b@(dd ( @^~0 0@ + Xs @ 0( S@ P @\ 7@50Q0QXH0 ( Hd\(S @ * XH @ 0( S@ $P (@\ 7@50Q0QX0 ( d\((0 0   \ 0$,  0}X (H0(PU Py 0  j 0 0 +  P  GX (H (PU @ Q  P P .4TU0T P  z0jjlkjkjBPjkjl&lkkjhj@kxk k`kd0h`@0 ^ *T0LA 1 U *X (H0 1(P QR09Pa'Ñ'R/ Rn  R X (HPU(:91a PA⣓  P:R8#8 R7h 7^  XT (H(PU<Y  H  \000 " )  c,2P R)$ Qh2PE0Q A@0,00,^ JX (H (PU400c  Q00 ^  ,  a0 R)4  ,<$)<  R 0 4 FP##!PE5 3L 0T PX0 0 d0S Q$  0S P@,c0F ( d( 34  Pc( @8

P | 0  0D4`(,` L V0n08Ā 1< @   RL< @`F>4! PL\ V L`6/`P PPd8@@8Pd[ $0b`dhP#*TL<C@! @U:L0 L D@P`FTL0 V L`6/`Pg T@L @QQ Q [L `FP UL z*V L`6/`PH8h`d 0Pdh  Q DH U :LH`F0PQL V L`6/`P H0 C8DPa D (,DQlR Ÿ0  4 @ Q4 (DP D0D4c\404 aD  c@0R1! lD0@  lD 0 R04D,4xD 03/PM(8hd @PA⮃`d 0RT8 #82 T7 h* [L `F0P UL *V L`6/`PhPd8Pf @@(PE[L`FP UL*V L ! bl0S@A`A @ 8D 8Q8@0A 008800 R@8#( \W 4@@0<"C\>8  @R8  R  pbU 0"S0bQ nQUp 0 [P 3 "R $0!$ p<@`0 $@bNa`4 4l U P R 8\. <@P  8 @ 0R < $ @L08@@04$@!000 8 P 8@ @08< 0<0L`D@$, (0`@0@ LA((0LC N0@(, }}>~~O-jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa%c%c%c%c%c%c%c%c%c%c deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly    L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`file errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream endincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O inflate 1.2.3 Copyright 1995-2005 Mark Adler @@ !1Aa  0@` #+3;CScs T[VV VQ QQ Q Q Q( s    }  x`oP xl\Aaeabi5TE libz.so.1.2.3|0.shstrtab.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.ARM.attributes.gnu_debuglink ,  }! ``* xx3.`9pp?E?MWcotPP    @LLpLg{070701002EC8D50000A1FF00000000000000000000000147CEFADB0000000D000000080000001100000000000000000000001200000000usr/lib/libz.so.1libz.so.1.2.3070701002EC780000041ED00000000000000000000000547CEFADB00000000000000080000001100000000000000000000000D00000000usr/lib/ipkg070701002EC8ED000081B400000000000000000000000147CEFADB00000D77000000080000001100000000000000000000001400000000usr/lib/ipkg/statusPackage: base-files Version: 3.0.14-r58 Status: install ok installed Architecture: cm-x270 Conffiles: /etc/fstab 3cb03d5e4e20b63dcef2f688274f953c /etc/hostname 99af12bf90e4db6f8c56a99ce919e232 Installed-Time: 1204746970 Package: base-passwd Version: 3.5.9-r2 Depends: uclibc (>= 0.9.29) Status: install ok installed Architecture: armv5te Installed-Time: 1204746970 Package: busybox Version: 1.01-r16 Depends: update-rc.d, uclibc (>= 0.9.29), libgcc1 (>= 4.1.2) Status: install ok installed Architecture: armv5te Conffiles: /etc/syslog.conf 0f2412c070ea45788338b9f6c637f07b Installed-Time: 1204746970 Package: initscripts Version: 1.0-r102 Depends: makedevs Status: install ok installed Architecture: armv5te Installed-Time: 1204746971 Package: libgcc1 Version: 4.1.2-r5 Depends: uclibc (>= 0.9.29) Status: install ok installed Architecture: armv5te Installed-Time: 1204746970 Package: liblzo2-2 Version: 2.02-r1 Depends: uclibc (>= 0.9.29) Status: install ok installed Architecture: armv5te Installed-Time: 1204746971 Package: libvolume-id0 Version: 115-r1 Depends: update-rc.d, uclibc (>= 0.9.29) Status: install ok installed Architecture: armv5te Installed-Time: 1204746971 Package: libz1 Version: 1.2.3-r2 Depends: uclibc (>= 0.9.29) Status: install ok installed Architecture: armv5te Installed-Time: 1204746971 Package: makedevs Version: 1.0.0-r5 Depends: uclibc (>= 0.9.29) Status: install ok installed Architecture: armv5te Installed-Time: 1204746971 Package: modutils-initscripts Version: 1.0-r2 Depends: update-rc.d Status: install ok installed Architecture: armv5te Installed-Time: 1204746971 Package: mtd-utils Version: 1.0.0+git-r6 Depends: uclibc (>= 0.9.29), libz1 (>= 1.2.3), liblzo2-2 (>= 2.02), libgcc1 (>= 4.1.2) Status: install user installed Architecture: armv5te Installed-Time: 1204746971 Package: netbase Version: 4.21-r15 Depends: update-rc.d Status: install ok installed Architecture: armv5te Conffiles: /etc/network/options a21c7f22ae5c58078b435ec00f85c74c /etc/hosts 27acad957c7cded40cd6ac50d23ddc66 /etc/network/interfaces 493a41c73b4527d9e27db5bae66eadff Installed-Time: 1204746971 Package: sysvinit Version: 2.86-r28 Depends: sysvinit-inittab, uclibc (>= 0.9.29) Status: install ok installed Architecture: armv5te Installed-Time: 1204746971 Package: sysvinit-inittab Version: 2.86-r28 Status: install ok installed Architecture: cm-x270 Conffiles: /etc/inittab 5e90ec03b5981962149fd5f4a56636b9 Installed-Time: 1204746971 Package: task-poky-boot Version: 1.0-r6 Depends: base-files, base-passwd, busybox, initscripts, modutils-initscripts, netbase, sysvinit, tinylogin, udev, update-alternatives-cworth Status: install user installed Architecture: cm-x270 Installed-Time: 1204746971 Package: tinylogin Version: 1.4-r4 Depends: uclibc (>= 0.9.29) Status: install ok installed Architecture: armv5te Installed-Time: 1204746971 Package: uclibc Version: 0.9.29-r9 Status: install ok installed Architecture: cm-x270 Installed-Time: 1204746970 Package: udev Version: 115-r1 Depends: update-rc.d, uclibc (>= 0.9.29), libvolume-id0 (>= 115) Provides: hotplug Status: install ok installed Architecture: armv5te Installed-Time: 1204746971 Package: update-alternatives-cworth Version: 0.99.154-r1 Provides: update-alternatives Status: install ok installed Architecture: all Installed-Time: 1204746971 Package: update-rc.d Version: 0.7-r1 Status: install ok installed Architecture: all Installed-Time: 1204746970 070701002EC781000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000001300000000usr/lib/ipkg/lists070701002EC904000041FD00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000001A00000000usr/lib/ipkg/alternatives070701002ECDA6000081B400000000000000000000000147CEFAFB00000025000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/telnet/usr/bin/telnet ../../bin/busybox 50 070701002ECD52000081B400000000000000000000000147CEFAF900000014000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/sed/bin/sed busybox 50 070701002ECC3B000081B400000000000000000000000147CEFAED00000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/ip/bin/ip busybox 50 070701002EC9BB000081B400000000000000000000000147CEFAE300000028000000080000001100000000000000000000002400000000usr/lib/ipkg/alternatives/deallocvt/usr/bin/deallocvt ../../bin/busybox 50 070701002ECCFF000081B400000000000000000000000147CEFAF400000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/mv/bin/mv busybox 50 070701002ECDDA000081B400000000000000000000000147CEFAFC00000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/uniq/usr/bin/uniq ../../bin/busybox 50 070701002ECD58000081B400000000000000000000000147CEFAF900000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/sleep/bin/sleep busybox 50 070701002ECD62000081B400000000000000000000000147CEFAFA0000002A000000080000001100000000000000000000002C00000000usr/lib/ipkg/alternatives/start-stop-daemon/sbin/start-stop-daemon ../bin/busybox 50 070701002ECBCD000081B400000000000000000000000147CEFAE900000019000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/hostname/bin/hostname busybox 50 070701002ECDDC000081B400000000000000000000000147CEFAFC00000024000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/xargs/usr/bin/xargs ../../bin/busybox 50 070701002ECE13000081B400000000000000000000000147CEFAFD00000021000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/reboot/sbin/reboot reboot.sysvinit 200 070701002ECAFE000081B400000000000000000000000147CEFAE70000001F000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/getkey/sbin/getkey ../bin/busybox 50 070701002EC985000081B400000000000000000000000147CEFAE400000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/egrep/bin/egrep busybox 50 070701002ECDE2000081B400000000000000000000000147CEFAFC00000021000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/wc/usr/bin/wc ../../bin/busybox 50 070701002ECDE0000081B400000000000000000000000147CEFAFC00000024000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/unzip/usr/bin/unzip ../../bin/busybox 50 070701002ECD37000081B400000000000000000000000147CEFAF800000027000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/readlink/usr/bin/readlink ../../bin/busybox 50 070701002EC957000081B400000000000000000000000147CEFADE00000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/chmod/bin/chmod busybox 50 070701002ECD41000081B400000000000000000000000147CEFAF800000024000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/reset/usr/bin/reset ../../bin/busybox 50 070701002ECD2B000081B400000000000000000000000147CEFAF700000023000000080000001100000000000000000000002500000000usr/lib/ipkg/alternatives/pivot_root/sbin/pivot_root ../bin/busybox 50 070701002ECCEB000081B400000000000000000000000147CEFAF200000021000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/modprobe/sbin/modprobe ../bin/busybox 50 070701002ECC15000081B400000000000000000000000147CEFAED0000001F000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/insmod/sbin/insmod ../bin/busybox 50 070701002ECC6D000081B400000000000000000000000147CEFAEF00000025000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/logger/usr/bin/logger ../../bin/busybox 50 070701002ECDF6000081B400000000000000000000000147CEFAFD00000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/zcat/bin/zcat busybox 50 070701002ECD97000081B400000000000000000000000147CEFAFB00000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/sync/bin/sync busybox 50 070701002ECC7C000081B400000000000000000000000147CEFAEF00000027000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/loadfont/usr/bin/loadfont ../../bin/busybox 50 070701002ECD27000081B400000000000000000000000147CEFAF700000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/ping/bin/ping busybox 50 070701002ECD59000081B400000000000000000000000147CEFAFA00000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/sort/usr/bin/sort ../../bin/busybox 50 070701002ECBB3000081B400000000000000000000000147CEFAE800000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/head/usr/bin/head ../../bin/busybox 50 070701002EC9B3000081B400000000000000000000000147CEFAE300000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/df/bin/df busybox 50 070701002ECD12000081B400000000000000000000000147CEFAF600000027000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/nslookup/usr/bin/nslookup ../../bin/busybox 50 070701002ECAE1000081B400000000000000000000000147CEFAE800000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/grep/bin/grep busybox 50 070701002ECA97000081B400000000000000000000000147CEFAE60000001E000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/fdisk/sbin/fdisk ../bin/busybox 50 070701002ECD29000081B400000000000000000000000147CEFAF700000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/ping6/bin/ping6 busybox 50 070701002ECCA3000081B400000000000000000000000147CEFAEF00000025000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/mkfifo/usr/bin/mkfifo ../../bin/busybox 50 070701002ECD9E000081B400000000000000000000000147CEFAFB00000022000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/tee/usr/bin/tee ../../bin/busybox 50 070701002ECDB0000081B400000000000000000000000147CEFAFC00000029000000080000001100000000000000000000002500000000usr/lib/ipkg/alternatives/traceroute/usr/bin/traceroute ../../bin/busybox 50 070701002ECCE9000081B400000000000000000000000147CEFAF300000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/mount/bin/mount busybox 50 070701002ECBC6000081B400000000000000000000000147CEFAF90000001E000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/route/sbin/route ../bin/busybox 50 070701002ECD2E000081B400000000000000000000000147CEFAF800000014000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/pwd/bin/pwd busybox 50 070701002ECBEE000081B400000000000000000000000147CEFAEB00000021000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/id/usr/bin/id ../../bin/busybox 50 070701002EC90E000081B400000000000000000000000147CEFADC00000027000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/basename/usr/bin/basename ../../bin/busybox 50 070701002ECDCD000081B400000000000000000000000147CEFAFC00000017000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/umount/bin/umount busybox 50 070701002ECA92000081B400000000000000000000000147CEFAE500000025000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/fbset/usr/sbin/fbset ../../bin/busybox 50 070701002ECD83000081B400000000000000000000000147CEFAFA00000020000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/swapoff/sbin/swapoff ../bin/busybox 50 070701002ECDB9000081B400000000000000000000000147CEFAFC00000026000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/udhcpd/usr/sbin/udhcpd ../../bin/busybox 50 070701002EC972000081B400000000000000000000000147CEFAE100000022000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/cut/usr/bin/cut ../../bin/busybox 50 070701002ECDE8000081B400000000000000000000000147CEFAFC00000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/vi/bin/vi busybox 50 070701002EC9B0000081B400000000000000000000000147CEFAE300000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/dd/bin/dd busybox 50 070701002ECC36000081B400000000000000000000000147CEFAED0000001E000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/klogd/sbin/klogd ../bin/busybox 50 070701002EC96B000081B400000000000000000000000147CEFAE100000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/cpio/bin/cpio busybox 50 070701002ECD34000081B400000000000000000000000147CEFAF80000001E000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/rmmod/sbin/rmmod ../bin/busybox 50 070701002ECE26000081B400000000000000000000000147CEFAFD00000020000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/wall/usr/bin/wall wall.sysvinit 200 070701002ECDA2000081B400000000000000000000000147CEFAFB00000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/test/usr/bin/test ../../bin/busybox 50 070701002ECE0E000081B400000000000000000000000147CEFAFD0000001D000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/halt/sbin/halt halt.sysvinit 200 070701002EC98F000081B400000000000000000000000147CEFAE100000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/date/bin/date busybox 50 070701002ECC7E000081B400000000000000000000000147CEFAEF00000021000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/loadkmap/sbin/loadkmap ../bin/busybox 50 070701002ECBDC000081B400000000000000000000000147CEFAEA00000020000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/hwclock/sbin/hwclock ../bin/busybox 50 070701002EC9D1000081B400000000000000000000000147CEFAF700000021000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/od/usr/bin/od ../../bin/busybox 50 070701002ECB8E000081B400000000000000000000000147CEFAE800000017000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/gunzip/bin/gunzip busybox 50 070701002EC8F1000081B400000000000000000000000147CEFADC00000021000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/ar/usr/bin/ar ../../bin/busybox 50 070701002ECC9B000081B400000000000000000000000147CEFAEF0000001E000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/lsmod/sbin/lsmod ../bin/busybox 50 070701002ECD24000081B400000000000000000000000147CEFAF700000025000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/openvt/usr/bin/openvt ../../bin/busybox 50 070701002EC9AA000081B400000000000000000000000147CEFAE300000026000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/dirname/usr/bin/dirname ../../bin/busybox 50 070701002ECDED000081B400000000000000000000000147CEFAFC00000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/wget/usr/bin/wget ../../bin/busybox 50 070701002EC9CA000081B400000000000000000000000147CEFAE400000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/echo/bin/echo busybox 50 070701002ECCA0000081B400000000000000000000000147CEFAEF00000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/mkdir/bin/mkdir busybox 50 070701002EC94E000081B400000000000000000000000147CEFADE00000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/chgrp/bin/chgrp busybox 50 070701002EC96E000081B400000000000000000000000147CEFAE000000024000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/clear/usr/bin/clear ../../bin/busybox 50 070701002EC9AE000081B400000000000000000000000147CEFAE400000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/expr/usr/bin/expr ../../bin/busybox 50 070701002ECD22000081B400000000000000000000000147CEFAF800000025000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/renice/usr/bin/renice ../../bin/busybox 50 070701002ECD96000081B400000000000000000000000147CEFAFB00000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/tail/usr/bin/tail ../../bin/busybox 50 070701002EC90D000081B400000000000000000000000147CEFADC00000022000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/awk/usr/bin/awk ../../bin/busybox 50 070701002EC992000081B400000000000000000000000147CEFAE300000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/dmesg/bin/dmesg busybox 50 070701002ECD54000081B400000000000000000000000147CEFAF900000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/sh/bin/sh busybox 50 070701002ECADD000081B400000000000000000000000147CEFAE600000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/free/usr/bin/free ../../bin/busybox 50 070701002EC9D8000081B400000000000000000000000147CEFAE400000022000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/env/usr/bin/env ../../bin/busybox 50 070701002ECDB2000081B400000000000000000000000147CEFAFC00000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/true/bin/true busybox 50 070701002ECE21000081B400000000000000000000000147CEFAFD00000020000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/mesg/usr/bin/mesg mesg.sysvinit 200 070701002ECC96000081B400000000000000000000000147CEFAEF00000020000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/losetup/sbin/losetup ../bin/busybox 50 070701002ECAB7000081B400000000000000000000000147CEFAE600000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/fgrep/bin/fgrep busybox 50 070701002ECDF0000081B400000000000000000000000147CEFAFC00000022000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/who/usr/bin/who ../../bin/busybox 50 070701002ECC90000081B400000000000000000000000147CEFAEF00000020000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/logread/sbin/logread ../bin/busybox 50 070701002ECD80000081B400000000000000000000000147CEFAFB00000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/time/usr/bin/time ../../bin/busybox 50 070701002ECD42000081B400000000000000000000000147CEFAF800000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/rm/bin/rm busybox 50 070701002ECDBE000081B400000000000000000000000147CEFAFC0000001F000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/udhcpc/sbin/udhcpc ../bin/busybox 50 070701002ECD87000081B400000000000000000000000147CEFAFA0000001F000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/swapon/sbin/swapon ../bin/busybox 50 070701002ECABC000081B400000000000000000000000147CEFAE600000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/find/usr/bin/find ../../bin/busybox 50 070701002ECD0C000081B400000000000000000000000147CEFAF500000018000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/netstat/bin/netstat busybox 50 070701002ECC4F000081B400000000000000000000000147CEFAED00000026000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/killall/usr/bin/killall ../../bin/busybox 50 070701002EC9BE000081B400000000000000000000000147CEFAE400000021000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/du/usr/bin/du ../../bin/busybox 50 070701002ECC8B000081B400000000000000000000000147CEFAEF00000026000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/logname/usr/bin/logname ../../bin/busybox 50 070701002ECD2F000081B400000000000000000000000147CEFAF800000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/ps/bin/ps busybox 50 070701002ECDF4000081B400000000000000000000000147CEFAFC00000025000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/whoami/usr/bin/whoami ../../bin/busybox 50 070701002ECB9A000081B400000000000000000000000147CEFAE800000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/gzip/bin/gzip busybox 50 070701002ECDAC000081B400000000000000000000000147CEFAFB00000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/touch/bin/touch busybox 50 070701002EC9B6000081B400000000000000000000000147CEFAE400000019000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/dumpkmap/bin/dumpkmap busybox 50 070701002ECDAE000081B400000000000000000000000147CEFAFB00000021000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/tr/usr/bin/tr ../../bin/busybox 50 070701002EC973000081B400000000000000000000000147CEFAE000000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/cp/bin/cp busybox 50 070701002ECCC9000081B400000000000000000000000147CEFAF200000017000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/mktemp/bin/mktemp busybox 50 070701002EC922000081B400000000000000000000000147CEFADC00000026000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/bunzip2/usr/bin/bunzip2 ../../bin/busybox 50 070701002ECD02000081B400000000000000000000000147CEFAF500000021000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/nc/usr/bin/nc ../../bin/busybox 50 070701002ECE2B000081B400000000000000000000000147CEFAFD00000022000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/init/sbin/init /sbin/init.sysvinit 50 070701002ECAD4000081B400000000000000000000000147CEFAE600000023000000080000001100000000000000000000002500000000usr/lib/ipkg/alternatives/fsck.minix/sbin/fsck.minix ../bin/busybox 50 070701002ECDA4000081B400000000000000000000000147CEFAFB00000022000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/top/usr/bin/top ../../bin/busybox 50 070701002ECDFA000081B400000000000000000000000147CEFAFC00000022000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/yes/usr/bin/yes ../../bin/busybox 50 070701002ECDA9000081B400000000000000000000000147CEFAFB00000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/tftp/usr/bin/tftp ../../bin/busybox 50 070701002EC9D7000081B400000000000000000000000147CEFAE500000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/false/bin/false busybox 50 070701002EC923000081B400000000000000000000000147CEFADD00000024000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/bzcat/usr/bin/bzcat ../../bin/busybox 50 070701002ECC18000081B400000000000000000000000147CEFAEB00000021000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/ifconfig/sbin/ifconfig ../bin/busybox 50 070701002EC967000081B400000000000000000000000147CEFADF00000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/chown/bin/chown busybox 50 070701002ECD6A000081B400000000000000000000000147CEFAFA00000026000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/strings/usr/bin/strings ../../bin/busybox 50 070701002ECC9E000081B400000000000000000000000147CEFAEF00000025000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/md5sum/usr/bin/md5sum ../../bin/busybox 50 070701002ECE1D000081B400000000000000000000000147CEFAFD00000020000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/last/usr/bin/last last.sysvinit 200 070701002EC95D000081B400000000000000000000000147CEFADF00000026000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/chroot/usr/sbin/chroot ../../bin/busybox 50 070701002EC91C000081B400000000000000000000000147CEFADD00000014000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/cat/bin/cat busybox 50 070701002ECDA0000081B400000000000000000000000147CEFAFB00000014000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/tar/bin/tar busybox 50 070701002ECC46000081B400000000000000000000000147CEFAED00000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/kill/bin/kill busybox 50 070701002ECC88000081B400000000000000000000000147CEFAEF00000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/ls/bin/ls busybox 50 070701002ECDDD000081B400000000000000000000000147CEFAFC00000024000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/which/usr/bin/which ../../bin/busybox 50 070701002EC99B000081B400000000000000000000000147CEFAE200000021000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/dc/usr/bin/dc ../../bin/busybox 50 070701002ECE14000081B400000000000000000000000147CEFAFD00000025000000080000001100000000000000000000002300000000usr/lib/ipkg/alternatives/shutdown/sbin/shutdown shutdown.sysvinit 200 070701002ECDA5000081B400000000000000000000000147CEFAFC00000022000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/tty/usr/bin/tty ../../bin/busybox 50 070701002ECCCE000081B400000000000000000000000147CEFAF10000001F000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/mkswap/sbin/mkswap ../bin/busybox 50 070701002EC8F2000081B400000000000000000000000147CEFADC00000014000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/ash/bin/ash busybox 50 070701002ECD7B000081B400000000000000000000000147CEFAFA00000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/stty/bin/stty busybox 50 070701002ECC79000081B400000000000000000000000147CEFAEE00000013000000080000001100000000000000000000001D00000000usr/lib/ipkg/alternatives/ln/bin/ln busybox 50 070701002EC964000081B400000000000000000000000147CEFADF00000023000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/chvt/usr/bin/chvt ../../bin/busybox 50 070701002ECD4C000081B400000000000000000000000147CEFAF90000001A000000080000001100000000000000000000002400000000usr/lib/ipkg/alternatives/run-parts/bin/run-parts busybox 50 070701002ECDE9000081B400000000000000000000000147CEFAFC00000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/watch/bin/watch busybox 50 070701002ECC2C000081B400000000000000000000000147CEFAED0000001D000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/ifup/sbin/ifup ../bin/busybox 50 070701002ECDD4000081B400000000000000000000000147CEFAFC00000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/uname/bin/uname busybox 50 070701002EC8FB000081B400000000000000000000000147CEFADB00000020000000080000001100000000000000000000001C00000000usr/lib/ipkg/alternatives/[/usr/bin/[ ../../bin/busybox 50 070701002ECD40000081B400000000000000000000000147CEFAF800000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/rmdir/bin/rmdir busybox 50 070701002ECCD0000081B400000000000000000000000147CEFAF300000015000000080000001100000000000000000000001F00000000usr/lib/ipkg/alternatives/more/bin/more busybox 50 070701002ECC19000081B400000000000000000000000147CEFAEC0000001F000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/ifdown/sbin/ifdown ../bin/busybox 50 070701002EC751000081B400000000000000000000000147CEFAF900000022000000080000001100000000000000000000001E00000000usr/lib/ipkg/alternatives/seq/usr/bin/seq ../../bin/busybox 50 070701002ECCC6000081B400000000000000000000000147CEFAF100000016000000080000001100000000000000000000002000000000usr/lib/ipkg/alternatives/mknod/bin/mknod busybox 50 070701002ECDDE000081B400000000000000000000000147CEFAFC00000025000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/uptime/usr/bin/uptime ../../bin/busybox 50 070701002ECBCA000081B400000000000000000000000147CEFAE800000026000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/hexdump/usr/bin/hexdump ../../bin/busybox 50 070701002ECCA8000081B400000000000000000000000147CEFAEF00000023000000080000001100000000000000000000002500000000usr/lib/ipkg/alternatives/mkfs.minix/sbin/mkfs.minix ../bin/busybox 50 070701002ECD2A000081B400000000000000000000000147CEFAF800000025000000080000001100000000000000000000002100000000usr/lib/ipkg/alternatives/printf/usr/bin/printf ../../bin/busybox 50 070701002ECD98000081B400000000000000000000000147CEFAFB00000020000000080000001100000000000000000000002200000000usr/lib/ipkg/alternatives/syslogd/sbin/syslogd ../bin/busybox 50 070701002EC782000041ED00000000000000000000000247CEFADB00000000000000080000001100000000000000000000001200000000usr/lib/ipkg/info070701002EC87E000081ED00000000000000000000000147CEEAFF000001E6000000080000001100000000000000000000002400000000usr/lib/ipkg/info/sysvinit.postinst update-alternatives --install /sbin/halt halt halt.sysvinit 200 update-alternatives --install /sbin/reboot reboot reboot.sysvinit 200 update-alternatives --install /sbin/shutdown shutdown shutdown.sysvinit 200 update-alternatives --install /usr/bin/last last last.sysvinit 200 update-alternatives --install /usr/bin/mesg mesg mesg.sysvinit 200 update-alternatives --install /usr/bin/wall wall wall.sysvinit 200 update-alternatives --install /sbin/init init /sbin/init.sysvinit 50 070701002EC78C000081A400000000000000000000000147CEEAF800000239000000080000001100000000000000000000002500000000usr/lib/ipkg/info/base-files.controlPackage: base-files Version: 3.0.14-r58 Description: Miscellaneous files for the base system. Section: base Priority: required Maintainer: OpenedHand Architecture: cm-x270 OE: base-files Homepage: unknown Source: file://rotation file://nsswitch.conf file://motd file://inputrc file://host.conf file://profile file://fstab file://filesystems file://issue.net file://issue file://usbd file://share/dot.bashrc file://share/dot.profile file://licenses/BSD file://licenses/GPL-2 file://licenses/LGPL-2 file://licenses/LGPL-2.1 file://licenses/Artistic 070701002EC892000081A400000000000000000000000147CEEB9B00000188000000080000001100000000000000000000002400000000usr/lib/ipkg/info/liblzo2-2.controlPackage: liblzo2-2 Version: 2.02-r1 Description: Lossless data compression library Section: libs Priority: optional Maintainer: OpenedHand Architecture: armv5te OE: lzo Homepage: http://www.oberhumer.com/opensource/lzo/ Depends: uclibc (>= 0.9.29) Source: http://www.oberhumer.com/opensource/lzo/download/lzo-2.02.tar.gz file://autofoo.patch;patch=1 file://acinclude.m4 070701002EC811000081A400000000000000000000000147CEEAFB000002BA000000080000001100000000000000000000002600000000usr/lib/ipkg/info/initscripts.controlPackage: initscripts Version: 1.0-r102 Description: SysV init scripts Section: base Priority: required Maintainer: OpenedHand Architecture: armv5te OE: initscripts Homepage: unknown Depends: makedevs Source: file://functions file://halt file://ramdisk file://umountfs file://devices file://devpts.sh file://devpts file://hostname.sh file://mountall.sh file://banner file://finish file://bootmisc.sh file://mountnfs.sh file://reboot file://checkfs.sh file://single file://sendsigs file://urandom file://rmnologin file://checkroot.sh file://umountnfs.sh file://sysfs.sh file://device_table.txt file://populate-volatile.sh file://volatiles file://save-rtc.sh file://alignment.sh 070701002EC8AF000081ED00000000000000000000000147CEEB6500000030000000080000001100000000000000000000002900000000usr/lib/ipkg/info/libvolume-id0.postinst#!/bin/sh if [ x"$D" = "x" ]; then ldconfig fi 070701002EC8CA000081B400000000000000000000000147CEFADB0000027F000000080000001100000000000000000000001C00000000usr/lib/ipkg/info/udev.list/usr/sbin/udevmonitor /etc/udev/rules.d/local.rules /lib/udev/vol_id /etc/udev/links.conf /etc/init.d/udev /etc/udev/rules.d/05-udev-early.rules /etc/udev/rules.d/udev.rules /etc/udev/rules.d/permissions.rules /lib/udev/firmware.sh /etc/udev/rules.d/95-udev-late.rules /etc/udev/scripts/network.sh /sbin/udevtrigger /etc/udev/udev.conf /etc/udev/rules.d/50-udev-default.rules /lib/udev/scsi_id /etc/scsi_id.config /sbin/udevd /etc/udev/mount.blacklist /etc/udev/scripts/mount.sh /etc/udev/rules.d/60-persistent-input.rules /etc/udev/rules.d/60-persistent-storage.rules /sbin/udevsettle /etc/udev/rules.d/80-drivers.rules /sbin/udevcontrol 070701002EC8DC000081B400000000000000000000000147CEFADB00000030000000080000001100000000000000000000002100000000usr/lib/ipkg/info/liblzo2-2.list/usr/lib/liblzo2.so.2 /usr/lib/liblzo2.so.2.0.0 070701002EC87F000081ED00000000000000000000000147CEEAFF00000040000000080000001100000000000000000000002200000000usr/lib/ipkg/info/sysvinit.postrm#!/bin/sh update-alternatives --remove init /sbin/init.sysvinit 070701002EC7CC000081ED00000000000000000000000147CEEA2E00000030000000080000001100000000000000000000002200000000usr/lib/ipkg/info/uclibc.postinst#!/bin/sh if [ x"$D" = "x" ]; then ldconfig fi 070701002EC864000081ED00000000000000000000000147CEEAFA0000002B000000080000001100000000000000000000002100000000usr/lib/ipkg/info/netbase.postrm#!/bin/sh update-rc.d $D networking remove 070701002EC89C000081B400000000000000000000000147CEFADB0000000D000000080000001100000000000000000000002800000000usr/lib/ipkg/info/sysvinit-inittab.list/etc/inittab 070701002EC89B000081A400000000000000000000000147CEEAFD000001C2000000080000001100000000000000000000002B00000000usr/lib/ipkg/info/sysvinit-inittab.controlPackage: sysvinit-inittab Version: 2.86-r28 Description: System-V like init. Section: base Priority: optional Maintainer: OpenedHand Architecture: cm-x270 OE: sysvinit Homepage: http://freshmeat.net/projects/sysvinit/ Source: ftp://ftp.cistron.nl/pub/people/miquels/sysvinit/sysvinit-2.86.tar.gz file://install.patch;patch=1 file://need file://provide file://inittab file://rcS-default file://rc file://rcS file://bootlogd.init 070701002EC861000081ED00000000000000000000000147CEEAFA00000044000000080000001100000000000000000000002000000000usr/lib/ipkg/info/netbase.prerm#!/bin/sh if test "x$D" = "x"; then /etc/init.d/networking stop fi 070701002EC8CF000081B400000000000000000000000147CEFADB00000033000000080000001100000000000000000000002500000000usr/lib/ipkg/info/libvolume-id0.list/lib/libvolume_id.so.0 /lib/libvolume_id.so.0.80.0 070701002EC863000081ED00000000000000000000000147CEEAFA0000007D000000080000001100000000000000000000002300000000usr/lib/ipkg/info/netbase.postinst#!/bin/sh if test "x$D" != "x"; then OPT="-r $D" else OPT="-s" fi update-rc.d $OPT networking start 40 S . stop 40 0 6 1 . 070701002EC8A9000081A400000000000000000000000147CEEB6500000339000000080000001100000000000000000000002800000000usr/lib/ipkg/info/libvolume-id0.controlPackage: libvolume-id0 Version: 115-r1 Description: udev is a daemon which dynamically creates and removes device nodes from /dev/, handles hotplug events and loads drivers at boot time. It replaces the hotplug package and requires a kernel not older than 2.6.12. Section: base Priority: optional Maintainer: OpenedHand Architecture: armv5te OE: udev Homepage: unknown Depends: update-rc.d, uclibc (>= 0.9.29) Source: http://kernel.org/pub/linux/utils/kernel/hotplug/udev-115.tar.gz file://noasmlinkage.patch;patch=1 file://flags.patch;patch=1 file://vol_id_ld.patch;patch=1 file://udevtrigger_add_devname_filtering.patch;patch=1 file://mount.blacklist file://udev.rules file://devfs-udev.rules file://links.conf file://permissions.rules file://mount.sh file://network.sh file://local.rules file://init 070701002EC7F7000081A400000000000000000000000147CEEB0500000011000000080000001100000000000000000000002400000000usr/lib/ipkg/info/busybox.conffiles/etc/syslog.conf 070701002EC8D3000081B400000000000000000000000147CEFADB0000001E000000080000001100000000000000000000003200000000usr/lib/ipkg/info/update-alternatives-cworth.list/usr/sbin/update-alternatives 070701002EC815000081B400000000000000000000000147CEFADB00000013000000080000001100000000000000000000001F00000000usr/lib/ipkg/info/libgcc1.list/lib/libgcc_s.so.1 070701002EC8CE000081B400000000000000000000000147CEFADB00000000000000080000001100000000000000000000002600000000usr/lib/ipkg/info/task-poky-boot.list070701002EC854000081B400000000000000000000000147CEFADB0000000F000000080000001100000000000000000000002000000000usr/lib/ipkg/info/makedevs.list/sbin/makedevs 070701002EC85E000081B400000000000000000000000147CEFADB00000018000000080000001100000000000000000000002C00000000usr/lib/ipkg/info/modutils-initscripts.list/etc/init.d/modutils.sh 070701002EC7D4000081B400000000000000000000000147CEFADB00000061000000080000001100000000000000000000002300000000usr/lib/ipkg/info/base-passwd.list/usr/sbin/update-passwd /usr/share/base-passwd/group.master /usr/share/base-passwd/passwd.master 070701002EC873000081A400000000000000000000000147CEEB660000035A000000080000001100000000000000000000001F00000000usr/lib/ipkg/info/udev.controlPackage: udev Version: 115-r1 Description: udev is a daemon which dynamically creates and removes device nodes from /dev/, handles hotplug events and loads drivers at boot time. It replaces the hotplug package and requires a kernel not older than 2.6.12. Section: base Priority: optional Maintainer: OpenedHand Architecture: armv5te OE: udev Homepage: unknown Depends: update-rc.d, uclibc (>= 0.9.29), libvolume-id0 (>= 115) Provides: hotplug Source: http://kernel.org/pub/linux/utils/kernel/hotplug/udev-115.tar.gz file://noasmlinkage.patch;patch=1 file://flags.patch;patch=1 file://vol_id_ld.patch;patch=1 file://udevtrigger_add_devname_filtering.patch;patch=1 file://mount.blacklist file://udev.rules file://devfs-udev.rules file://links.conf file://permissions.rules file://mount.sh file://network.sh file://local.rules file://init 070701002EC85B000081ED00000000000000000000000147CEEAFF0000006E000000080000001100000000000000000000003000000000usr/lib/ipkg/info/modutils-initscripts.postinst#!/bin/sh if test "x$D" != "x"; then OPT="-r $D" else OPT="-s" fi update-rc.d $OPT modutils.sh start 20 S . 070701002EC7CB000081B400000000000000000000000147CEFADB000000EF000000080000001100000000000000000000002200000000usr/lib/ipkg/info/base-files.list/mnt/ram /etc/nsswitch.conf /etc/default/usbd /mnt/card /etc/inputrc /etc/fstab /etc/issue /etc/hostname /etc/profile /mnt/net /etc/motd /etc/host.conf /etc/mtab /etc/skel/.bashrc /etc/issue.net /etc/skel/.profile /etc/filesystems /mnt/cf 070701002EC87C000081ED00000000000000000000000147CEEAFF00000132000000080000001100000000000000000000002100000000usr/lib/ipkg/info/sysvinit.prerm update-alternatives --remove halt halt.sysvinit update-alternatives --remove reboot reboot.sysvinit update-alternatives --remove shutdown shutdown.sysvinit update-alternatives --remove last last.sysvinit update-alternatives --remove mesg mesg.sysvinit update-alternatives --remove wall wall.sysvinit 070701002EC6DA000081ED00000000000000000000000147CEEB660000003E000000080000001100000000000000000000001D00000000usr/lib/ipkg/info/udev.prerm#!/bin/sh if test "x$D" = "x"; then /etc/init.d/udev stop fi 070701002EC87D000081A400000000000000000000000147CEEAFF000001E8000000080000001100000000000000000000002300000000usr/lib/ipkg/info/sysvinit.controlPackage: sysvinit Version: 2.86-r28 Description: System-V like init. Section: base Priority: optional Maintainer: OpenedHand Architecture: armv5te OE: sysvinit Homepage: http://freshmeat.net/projects/sysvinit/ Depends: sysvinit-inittab, uclibc (>= 0.9.29) Source: ftp://ftp.cistron.nl/pub/people/miquels/sysvinit/sysvinit-2.86.tar.gz file://install.patch;patch=1 file://need file://provide file://inittab file://rcS-default file://rc file://rcS file://bootlogd.init 070701002EC78B000081A400000000000000000000000147CEEA2E000002DE000000080000001100000000000000000000002100000000usr/lib/ipkg/info/uclibc.controlPackage: uclibc Version: 0.9.29-r9 Description: C library for embedded systems Section: libs Priority: required Maintainer: OpenedHand Architecture: cm-x270 OE: uclibc Homepage: unknown Source: file://uClibc.config file://uClibc.machine file://uClibc.distro file://errno_values.h.patch;patch=1 file://termios.h.patch;patch=1 file://uClibc-0.9.29-001-fix-mmap.patch;patch=1 file://uClibc-0.9.29-conditional-sched_affinity.patch;patch=1 file://uClibc-0.9.29-fix-gethostent_r-failure-retval.patch;patch=1 file://uClibc-0.9.29-fix-internal_function-definition.patch;patch=1 file://uClibc-0.9.29-rm-whitespace.patch;patch=1 file://arm_fix_alignment.patch;patch=1 http://www.uclibc.org/downloads/uClibc-0.9.29.tar.bz2 070701002EC8DE000081B400000000000000000000000147CEFADB0000002A000000080000001100000000000000000000001D00000000usr/lib/ipkg/info/libz1.list/usr/lib/libz.so.1 /usr/lib/libz.so.1.2.3 070701002EC862000081A400000000000000000000000147CEEAFA000001A3000000080000001100000000000000000000002200000000usr/lib/ipkg/info/netbase.controlPackage: netbase Version: 4.21-r15 Description: This package provides the necessary infrastructure for basic TCP/IP based networking. Section: base Priority: optional Maintainer: OpenedHand Architecture: armv5te OE: netbase Homepage: unknown Depends: update-rc.d Source: ftp://ftp.debian.org/debian/pool/main/n/netbase/netbase_4.21.tar.gz file://options file://init file://hosts file://interfaces 070701002EC85C000081ED00000000000000000000000147CEEAFF0000002C000000080000001100000000000000000000002E00000000usr/lib/ipkg/info/modutils-initscripts.postrm#!/bin/sh update-rc.d $D modutils.sh remove 070701002EC8D6000081A400000000000000000000000147CEEB7000000162000000080000001100000000000000000000002000000000usr/lib/ipkg/info/libz1.controlPackage: libz1 Version: 1.2.3-r2 Description: Zlib Compression Library Section: libs Priority: required Maintainer: OpenedHand Architecture: armv5te OE: zlib Homepage: http://www.gzip.org/zlib/ Depends: uclibc (>= 0.9.29) Source: http://www.zlib.net/zlib-1.2.3.tar.bz2 file://visibility.patch;patch=1 file://autotools.patch;patch=1 070701002EC8DA000081ED00000000000000000000000147CEEB7000000030000000080000001100000000000000000000002100000000usr/lib/ipkg/info/libz1.postinst#!/bin/sh if [ x"$D" = "x" ]; then ldconfig fi 070701002EC813000081ED00000000000000000000000147CEEAD900000030000000080000001100000000000000000000002300000000usr/lib/ipkg/info/libgcc1.postinst#!/bin/sh if [ x"$D" = "x" ]; then ldconfig fi 070701002EC8EC000081B400000000000000000000000147CEFADB0000013C000000080000001100000000000000000000002100000000usr/lib/ipkg/info/mtd-utils.list/usr/bin/flash_info /usr/bin/doc_loadbios /usr/bin/ftl_check /usr/bin/jffs2dump /usr/bin/ftl_format /usr/bin/mkfs.jffs /usr/bin/flash_erase /usr/bin/flash_eraseall /usr/bin/nanddump /usr/bin/flash_lock /usr/bin/mtd_debug /usr/bin/flashcp /usr/bin/flash_unlock /usr/bin/mkfs.jffs2 /usr/bin/sumtool /usr/bin/nandwrite 070701002EC80E000081A400000000000000000000000147CEEB79000001D9000000080000001100000000000000000000002900000000usr/lib/ipkg/info/task-poky-boot.controlPackage: task-poky-boot Version: 1.0-r6 Description: Task for OpenedHand Poky - minimal bootable image Section: base Priority: optional Maintainer: OpenedHand Architecture: cm-x270 OE: task-poky-boot Homepage: unknown Depends: base-files, base-passwd, busybox, initscripts, modutils-initscripts, netbase, sysvinit, tinylogin, udev, update-alternatives-cworth Source: file:///srv/poky/autobuild/full-shihtzu/build/meta/packages/tasks/task-poky-boot.bb 070701002EC872000081B400000000000000000000000147CEFADB0000008C000000080000001100000000000000000000001F00000000usr/lib/ipkg/info/netbase.list/etc/hosts /etc/protocols /etc/network/interfaces /etc/rpc /usr/sbin/update-inetd /etc/services /etc/init.d/networking /etc/network/options 070701002EC859000081ED00000000000000000000000147CEEAFF00000045000000080000001100000000000000000000002D00000000usr/lib/ipkg/info/modutils-initscripts.prerm#!/bin/sh if test "x$D" = "x"; then /etc/init.d/modutils.sh stop fi 070701002EC812000081A400000000000000000000000147CEEAD900000470000000080000001100000000000000000000002200000000usr/lib/ipkg/info/libgcc1.controlPackage: libgcc1 Version: 4.1.2-r5 Description: The GNU cc and gcc C compilers. Section: devel Priority: optional Maintainer: OpenedHand Architecture: armv5te OE: gcc-cross Homepage: http://www.gnu.org/software/gcc/ Depends: uclibc (>= 0.9.29) Source: ftp://ftp.gnu.org/pub/gnu/gcc/gcc-4.1.2/gcc-4.1.2.tar.bz2 file://100-uclibc-conf.patch;patch=1 file://110-arm-eabi.patch;patch=1 file://200-uclibc-locale.patch;patch=1 file://300-libstdc++-pic.patch;patch=1 file://301-missing-execinfo_h.patch;patch=1 file://302-c99-snprintf.patch;patch=1 file://303-c99-complex-ugly-hack.patch;patch=1 file://304-index_macro.patch;patch=1 file://602-sdk-libstdc++-includes.patch;patch=1 file://740-sh-pr24836.patch;patch=1 file://800-arm-bigendian.patch;patch=1 file://arm-nolibfloat.patch;patch=1 file://arm-softfloat.patch;patch=1 file://gcc41-configure.in.patch;patch=1 file://arm-thumb.patch;patch=1 file://arm-thumb-cache.patch;patch=1 file://ldflags.patch;patch=1 file://zecke-xgcc-cpp.patch;patch=1 file://unbreak-armv4t.patch;patch=1 file://fix-ICE-in-arm_unwind_emit_set.diff;patch=1 file://cache-amnesia.patch;patch=1 070701002EC893000081B400000000000000000000000147CEFADB00000137000000080000001100000000000000000000002000000000usr/lib/ipkg/info/sysvinit.list/sbin/halt.sysvinit /sbin/runlevel /usr/bin/wall.sysvinit /etc/default/rcS /etc/init.d/rc /usr/bin/utmpdump /bin/mountpoint /sbin/shutdown.sysvinit /etc/init.d/rcS /usr/bin/mesg.sysvinit /sbin/reboot.sysvinit /usr/bin/lastb /sbin/poweroff /usr/bin/last.sysvinit /sbin/telinit /sbin/init.sysvinit /sbin/killall5 070701002EC770000081A400000000000000000000000147CEEAF800000019000000080000001100000000000000000000002700000000usr/lib/ipkg/info/base-files.conffiles/etc/fstab /etc/hostname 070701002EC8A5000081B400000000000000000000000147CEFADB00000091000000080000001100000000000000000000002100000000usr/lib/ipkg/info/tinylogin.list/bin/addgroup /usr/bin/passwd /bin/login /bin/su /sbin/sulogin /bin/adduser /bin/delgroup /bin/deluser /bin/tinylogin /sbin/getty /usr/bin/vlock 070701002EC74B000081A400000000000000000000000147CEEAF60000014C000000080000001100000000000000000000002600000000usr/lib/ipkg/info/update-rc.d.controlPackage: update-rc.d Version: 0.7-r1 Description: Manage symlinks in /etc/rcN.d Section: base Priority: standard Maintainer: OpenedHand Architecture: all OE: update-rc.d Homepage: unknown Source: cvs://anoncvs:anoncvs@anoncvs.handhelds.org/cvs;module=apps/update-rc.d;tag=r0_7 file://add-verbose.patch;patch=1 070701002EC7CE000081A400000000000000000000000147CEEB5A000001C2000000080000001100000000000000000000002600000000usr/lib/ipkg/info/base-passwd.controlPackage: base-passwd Version: 3.5.9-r2 Description: Base system password/group files. Section: base Priority: optional Maintainer: OpenedHand Architecture: armv5te OE: base-passwd Homepage: unknown Depends: uclibc (>= 0.9.29) Source: ftp://ftp.debian.org/debian/pool/main/b/base-passwd/base-passwd_3.5.9.tar.gz file://configure.patch;patch=1 file://nobash.patch;patch=1 file://root-home.patch;patch=1 file://mysql.patch;patch=1 070701002EC7FD000081ED00000000000000000000000147CEEB0500000027000000080000001100000000000000000000002100000000usr/lib/ipkg/info/busybox.postrm#!/bin/sh update-rc.d $D syslog remove 070701002EC860000081A400000000000000000000000147CEEAFA00000038000000080000001100000000000000000000002400000000usr/lib/ipkg/info/netbase.conffiles/etc/network/options /etc/hosts /etc/network/interfaces 070701002EC8D4000081ED00000000000000000000000147CEEB9B00000030000000080000001100000000000000000000002500000000usr/lib/ipkg/info/liblzo2-2.postinst#!/bin/sh if [ x"$D" = "x" ]; then ldconfig fi 070701002EC806000081B400000000000000000000000147CEFADB000000C8000000080000001100000000000000000000001F00000000usr/lib/ipkg/info/busybox.list/etc/busybox.links /etc/udhcpc.d/50default /usr/sbin/udhcpd /etc/init.d/syslog /sbin/udhcpc /bin/sh /etc/syslog.conf /bin/busybox /usr/share/udhcpc/default.script /sbin/hwclock /etc/init.d/hwclock.sh 070701002EC879000081A400000000000000000000000147CEEB0300000270000000080000001100000000000000000000002400000000usr/lib/ipkg/info/tinylogin.controlPackage: tinylogin Version: 1.4-r4 Description: TinyLogin is a suite of tiny UNIX utilities for handling logins, user authentication, changing passwords, and otherwise maintaining users and groups on an embedded system. Section: base Priority: optional Maintainer: OpenedHand Architecture: armv5te OE: tinylogin Homepage: http://tinylogin.busybox.net/ Depends: uclibc (>= 0.9.29) Source: http://tinylogin.busybox.net/downloads/tinylogin-1.4.tar.bz2 file://cvs-20040608.patch;patch=1;pnum=1 file://add-system.patch;patch=1;pnum=1 file://adduser-empty_pwd.patch;patch=1 file://remove-index.patch;patch=1 070701002EC7FA000081A400000000000000000000000147CEEB050000064E000000080000001100000000000000000000002200000000usr/lib/ipkg/info/busybox.controlPackage: busybox Version: 1.01-r16 Description: BusyBox combines tiny versions of many common UNIX utilities into a single small executable. It provides minimalist replacements for most of the utilities you usually find in GNU fileutils, shellutils, etc. The utilities in BusyBox generally have fewer options than their full-featured GNU cousins; however, the options that are included provide the expected functionality and behave very much like their GNU counterparts. BusyBox provides a fairly complete POSIX environment for any small or embedded system. Section: base Priority: required Maintainer: OpenedHand Architecture: armv5te OE: busybox Homepage: http://www.busybox.net Depends: update-rc.d, uclibc (>= 0.9.29), libgcc1 (>= 4.1.2) Source: http://www.busybox.net/downloads/busybox-1.01.tar.gz file://no_strip.patch;patch=1 file://udhcppidfile.patch;patch=1 file://udhcppidfile-breakage.patch;patch=1 file://add-getkey-applet.patch;patch=1 file://below.patch;patch=1 file://dhcp-hostname.patch;patch=1 file://dhcpretrytime.patch;patch=1 file://fbset.patch;patch=1 file://hdparm_M.patch;patch=1 file://ifupdown-spurious-environ.patch;patch=1 file://iproute-flush-cache.patch;patch=1;pnum=0 file://mount-all-type.patch;patch=1 file://readlink.patch;patch=1 file://rmmod.patch;patch=1 file://udhcpscript.patch;patch=1 file://thumb-bsdlabel.patch;patch=1 file://glibc2.4-icmp6.patch;patch=1 file://defconfig file://busybox-cron file://busybox-httpd file://busybox-udhcpd file://syslog file://hwclock.sh file://default.script file://syslog.conf file://mount.busybox file://umount.busybox 070701002EC852000081B400000000000000000000000147CEFADB000004D1000000080000001100000000000000000000002300000000usr/lib/ipkg/info/initscripts.list/etc/init.d/bootmisc.sh /etc/init.d/devpts.sh /etc/init.d/alignment.sh /etc/rc6.d/S31umountnfs.sh /etc/rc5.d/S99rmnologin /etc/default/devpts /etc/rcS.d/S55bootmisc.sh /etc/init.d/functions /etc/rcS.d/S03sysfs /etc/rcS.d/S39hostname.sh /etc/init.d/reboot /etc/rc3.d/S99rmnologin /etc/init.d/finish /etc/rc0.d/S90halt /etc/rc6.d/S40umountfs /etc/init.d/banner /etc/init.d/devices /etc/rc6.d/S90reboot /etc/rc0.d/S40umountfs /etc/rcS.d/S35mountall.sh /etc/rc0.d/S25save-rtc.sh /etc/rc6.d/S25save-rtc.sh /etc/init.d/umountnfs.sh /etc/rcS.d/S05devices /etc/init.d/mountnfs.sh /etc/rcS.d/S37populate-volatile.sh /etc/init.d/populate-volatile.sh /etc/rcS.d/S06alignment /etc/rcS.d/S30ramdisk /etc/default/volatiles/00_core /etc/rc6.d/S20sendsigs /etc/rcS.d/S02banner /etc/rcS.d/S10checkroot.sh /etc/init.d/single /etc/rc0.d/S20sendsigs /etc/init.d/umountfs /etc/rc4.d/S99rmnologin /etc/init.d/sysfs.sh /etc/init.d/halt /etc/rc2.d/S99rmnologin /etc/rcS.d/S38devpts.sh /etc/init.d/checkroot.sh /etc/init.d/sendsigs /etc/rcS.d/S99finish /etc/init.d/hostname.sh /etc/init.d/mountall.sh /etc/init.d/save-rtc.sh /etc/device_table /etc/init.d/urandom /etc/rcS.d/S45mountnfs.sh /etc/init.d/ramdisk /etc/init.d/rmnologin /etc/rc0.d/S31umountnfs.sh 070701002EC78A000081A400000000000000000000000147CEEAF300000106000000080000001100000000000000000000002300000000usr/lib/ipkg/info/makedevs.controlPackage: makedevs Version: 1.0.0-r5 Description: A tool to make device nodes Section: base Priority: required Maintainer: OpenedHand Architecture: armv5te OE: makedevs Homepage: unknown Depends: uclibc (>= 0.9.29) Source: file://makedevs.c 070701002EC857000081A400000000000000000000000147CEEAFD0000018F000000080000001100000000000000000000003500000000usr/lib/ipkg/info/update-alternatives-cworth.controlPackage: update-alternatives-cworth Version: 0.99.154-r1 Description: Version 0.99.154-r1 of package update-alternatives-cworth Section: base Priority: optional Maintainer: OpenedHand Architecture: all OE: update-alternatives-cworth Homepage: unknown Provides: update-alternatives Source: cvs://anoncvs:anoncvs@anoncvs.handhelds.org/cvs;module=familiar/dist/ipkg;tag=V0-99-154 070701002EC894000081ED00000000000000000000000147CEEB6600000067000000080000001100000000000000000000002000000000usr/lib/ipkg/info/udev.postinst#!/bin/sh if test "x$D" != "x"; then OPT="-r $D" else OPT="-s" fi update-rc.d $OPT udev start 03 S . 070701002EC8AA000081ED00000000000000000000000147CEEB6600000025000000080000001100000000000000000000001E00000000usr/lib/ipkg/info/udev.postrm#!/bin/sh update-rc.d $D udev remove 070701002EC89A000081A400000000000000000000000147CEEAFD0000000D000000080000001100000000000000000000002D00000000usr/lib/ipkg/info/sysvinit-inittab.conffiles/etc/inittab 070701002EC7CF000081ED00000000000000000000000147CEEB5A000000CF000000080000001100000000000000000000002700000000usr/lib/ipkg/info/base-passwd.postinst set -e if [ ! -e $D/etc/passwd ] ; then cp $D/usr/share/base-passwd/passwd.master $D/etc/passwd fi if [ ! -e $D/etc/group ] ; then cp $D/usr/share/base-passwd/group.master $D/etc/group fi exit 0 070701002EC7F9000081ED00000000000000000000000147CEEB05000003EE000000080000001100000000000000000000002000000000usr/lib/ipkg/info/busybox.prerm # This is so you can make busybox commit suicide - removing busybox with no other packages # providing its files, this will make update-alternatives work, but the update-rc.d part # for syslog, httpd and/or udhcpd will fail if there is no other package providing sh tmpdir=`mktemp -d /tmp/busyboxrm-XXXXXX` ln -s /bin/busybox $tmpdir/[ ln -s /bin/busybox $tmpdir/test ln -s /bin/busybox $tmpdir/head ln -s /bin/busybox $tmpdir/sh ln -s /bin/busybox $tmpdir/basename ln -s /bin/busybox $tmpdir/echo ln -s /bin/busybox $tmpdir/mv ln -s /bin/busybox $tmpdir/ln ln -s /bin/busybox $tmpdir/dirname ln -s /bin/busybox $tmpdir/rm ln -s /bin/busybox $tmpdir/sed ln -s /bin/busybox $tmpdir/sort export PATH=$PATH:$tmpdir while read link; do case "$link" in /*/*/*) to="../../bin/busybox";; /bin/*) to="busybox";; /*/*) to="../bin/busybox";; esac; bn=`basename $link`; sh /usr/bin/update-alternatives --remove $bn $to; done /dev/null || alias test='busybox test' if test "x$D" = "x"; then while read link; do if test ! -h "$link"; then case "$link" in /*/*/*) to="../../bin/busybox";; /bin/*) to="busybox";; /*/*) to="../bin/busybox";; esac; busybox ln -s $to $link; fi; done Architecture: armv5te OE: modutils-initscripts Homepage: unknown Depends: update-rc.d Source: file://modutils.sh 070701002EC895000081A400000000000000000000000147CEEBA000000222000000080000001100000000000000000000002400000000usr/lib/ipkg/info/mtd-utils.controlPackage: mtd-utils Version: 1.0.0+git-r6 Description: Tools for managing memory technology devices. Section: base Priority: optional Maintainer: OpenedHand Architecture: armv5te OE: mtd-utils Homepage: http://www.linux-mtd.infradead.org/ Depends: uclibc (>= 0.9.29), libz1 (>= 1.2.3), liblzo2-2 (>= 2.02), libgcc1 (>= 4.1.2) Source: git://git.infradead.org/mtd-utils.git;protocol=git;tag=2a032bca585e27ceb0f293905718b416bc297ce2 file://add-exclusion-to-mkfs-jffs2-git.patch;patch=1 file://fix-ignoreerrors-git.patch;patch=1 070701002EC7AE000041ED00000000000000000000000847CEFADA00000000000000080000001100000000000000000000000A00000000usr/share070701002EC7AF000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000F00000000usr/share/misc070701002EC7F5000041ED00000000000000000000000247CEFADA00000000000000080000001100000000000000000000001100000000usr/share/udhcpc070701002EC7F6000081ED00000000000000000000000147CEEB0400000031000000080000001100000000000000000000002000000000usr/share/udhcpc/default.script#!/bin/sh exec run-parts -a "$1" /etc/udhcpc.d 070701002EC7B0000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000E00000000usr/share/man070701002EC7D1000041ED00000000000000000000000247CEFADA00000000000000080000001100000000000000000000001600000000usr/share/base-passwd070701002EC7D2000081A400000000000000000000000147CEE8CD000002CF000000080000001100000000000000000000002400000000usr/share/base-passwd/passwd.masterroot::0:0:root:/home/root:/bin/sh daemon:*:1:1:daemon:/usr/sbin:/bin/sh bin:*:2:2:bin:/bin:/bin/sh sys:*:3:3:sys:/dev:/bin/sh sync:*:4:65534:sync:/bin:/bin/sync games:*:5:60:games:/usr/games:/bin/sh man:*:6:12:man:/var/cache/man:/bin/sh lp:*:7:7:lp:/var/spool/lpd:/bin/sh mail:*:8:8:mail:/var/mail:/bin/sh news:*:9:9:news:/var/spool/news:/bin/sh uucp:*:10:10:uucp:/var/spool/uucp:/bin/sh proxy:*:13:13:proxy:/bin:/bin/sh www-data:*:33:33:www-data:/var/www:/bin/sh backup:*:34:34:backup:/var/backups:/bin/sh list:*:38:38:Mailing List Manager:/var/list:/bin/sh irc:*:39:39:ircd:/var/run/ircd:/bin/sh gnats:*:41:41:Gnats Bug-Reporting System (admin):/var/lib/gnats:/bin/sh nobody:*:65534:65534:nobody:/nonexistent:/bin/sh 070701002EC7D3000081A400000000000000000000000147CEE8CD000001CD000000080000001100000000000000000000002300000000usr/share/base-passwd/group.masterroot:*:0: daemon:*:1: bin:*:2: sys:*:3: adm:*:4: tty:*:5: disk:*:6: lp:*:7: mail:*:8: news:*:9: uucp:*:10: man:*:12: proxy:*:13: kmem:*:15: dialout:*:20: fax:*:21: voice:*:22: cdrom:*:24: floppy:*:25: tape:*:26: sudo:*:27: audio:*:29: dip:*:30: www-data:*:33: backup:*:34: operator:*:37: list:*:38: irc:*:39: src:*:40: gnats:*:41: shadow:*:42: utmp:*:43: video:*:44: sasl:*:45: plugdev:*:46: staff:*:50: games:*:60: users:*:100: mysql:*:64001: nogroup:*:65534: 070701002EC7B1000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000F00000000usr/share/info070701002EC7B2000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000F00000000usr/share/dict070701002EC7B3000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000C00000000usr/include070701002EC7B4000045ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000800000000usr/src070701002EC7B5000043FF00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000400000000tmp070701002EC7B6000041ED00000000000000000000000347CEFADA00000000000000080000001100000000000000000000000500000000home070701002EC7B7000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000A00000000home/root070701002EC7B8000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000500000000boot070701002EC7B9000041ED00000000000000000000001247CEFAFD00000000000000080000001100000000000000000000000400000000etc070701002EC816000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000A00000000etc/rc2.d070701002EC8170000A1FF00000000000000000000000147CEFADB00000013000000080000001100000000000000000000001700000000etc/rc2.d/S99rmnologin../init.d/rmnologin070701002ECDF10000A1FF00000000000000000000000147CEFAFD00000010000000080000001100000000000000000000001400000000etc/rc2.d/S20syslog../init.d/syslog070701002EC7FB000081A400000000000000000000000147CEEB04000006D5000000080000001100000000000000000000001200000000etc/busybox.links/usr/bin/[ /usr/bin/ar /bin/ash /usr/bin/awk /usr/bin/basename /usr/bin/bunzip2 /usr/bin/bzcat /bin/cat /bin/chgrp /bin/chmod /bin/chown /usr/sbin/chroot /usr/bin/chvt /usr/bin/clear /bin/cp /bin/cpio /usr/bin/cut /bin/date /usr/bin/dc /bin/dd /usr/bin/deallocvt /bin/df /usr/bin/dirname /bin/dmesg /usr/bin/du /bin/dumpkmap /bin/echo /bin/egrep /usr/bin/env /usr/bin/expr /bin/false /usr/sbin/fbset /sbin/fdisk /bin/fgrep /usr/bin/find /usr/bin/free /sbin/fsck.minix /sbin/getkey /bin/grep /bin/gunzip /bin/gzip /usr/bin/head /usr/bin/hexdump /bin/hostname /sbin/hwclock /usr/bin/id /sbin/ifconfig /sbin/ifdown /sbin/ifup /sbin/insmod /bin/ip /bin/kill /usr/bin/killall /sbin/klogd /bin/ln /usr/bin/loadfont /sbin/loadkmap /usr/bin/logger /usr/bin/logname /sbin/logread /sbin/losetup /bin/ls /sbin/lsmod /usr/bin/md5sum /bin/mkdir /usr/bin/mkfifo /sbin/mkfs.minix /bin/mknod /sbin/mkswap /bin/mktemp /sbin/modprobe /bin/more /bin/mount /bin/mv /usr/bin/nc /bin/netstat /usr/bin/nslookup /usr/bin/od /usr/bin/openvt /bin/ping /bin/ping6 /sbin/pivot_root /usr/bin/printf /bin/ps /bin/pwd /usr/bin/readlink /usr/bin/renice /usr/bin/reset /bin/rm /bin/rmdir /sbin/rmmod /sbin/route /bin/run-parts /bin/sed /usr/bin/seq /bin/sh /bin/sleep /usr/bin/sort /sbin/start-stop-daemon /usr/bin/strings /bin/stty /sbin/swapoff /sbin/swapon /bin/sync /sbin/syslogd /usr/bin/tail /bin/tar /usr/bin/tee /usr/bin/telnet /usr/bin/test /usr/bin/tftp /usr/bin/time /usr/bin/top /bin/touch /usr/bin/tr /usr/bin/traceroute /bin/true /usr/bin/tty /sbin/udhcpc /usr/sbin/udhcpd /bin/umount /bin/uname /usr/bin/uniq /usr/bin/unzip /usr/bin/uptime /bin/vi /bin/watch /usr/bin/wc /usr/bin/wget /usr/bin/which /usr/bin/who /usr/bin/whoami /usr/bin/xargs /usr/bin/yes /bin/zcat 070701002EC7BA000081A400000000000000000000000147CEEAEA00000008000000080000001100000000000000000000000D00000000etc/hostnamecm-x270 070701002EC7BB000081A400000000000000000000000147CEEAEA0000001B000000080000001100000000000000000000001000000000etc/filesystemsminix fat vfat ext2 ext3 * 070701002EC8B7000081A400000000000000000000000147CEEB610000029A000000080000001100000000000000000000001300000000etc/scsi_id.config# # scsi_id configuration # # lower or upper case has no effect on the left side. Quotes (") are # required for spaces in values. Model is the same as the SCSI # INQUIRY product identification field. Per the SCSI INQUIRY, the vendor # is limited to 8 bytes, model to 16 bytes. # # The first matching line found is used. Short matches match longer ones, # if you do not want such a match space fill the extra bytes. If no model # is specified, only the vendor string need match. # # options= # vendor=string[,model=string],options= # some libata drives require vpd page 0x80 vendor="ATA",options=-p 0x80 070701002EC7FE000081A400000000000000000000000147CEEB04000001FC000000080000001100000000000000000000001000000000etc/syslog.confDESTINATION="buffer" # log destinations (buffer file remote) MARKINT=20 # intervall between --mark-- entries LOGFILE=/var/log/messages # where to log (file) REMOTE=loghost:514 # where to log (syslog remote) REDUCE=no # reduce-size logging #ROTATESIZE=0 # rotate log if grown beyond X [kByte] (incompatible with busybox) #ROTATEGENS=3 # keep X generations of rotated logs (incompatible with busybox) BUFFERSIZE=64 # size of circular buffer [kByte] FOREGROUND=no # run in foreground (don't use!) 070701002EC8F3000081A400000000000000000000000147CEFADB000002CF000000080000001100000000000000000000000B00000000etc/passwdroot::0:0:root:/home/root:/bin/sh daemon:*:1:1:daemon:/usr/sbin:/bin/sh bin:*:2:2:bin:/bin:/bin/sh sys:*:3:3:sys:/dev:/bin/sh sync:*:4:65534:sync:/bin:/bin/sync games:*:5:60:games:/usr/games:/bin/sh man:*:6:12:man:/var/cache/man:/bin/sh lp:*:7:7:lp:/var/spool/lpd:/bin/sh mail:*:8:8:mail:/var/mail:/bin/sh news:*:9:9:news:/var/spool/news:/bin/sh uucp:*:10:10:uucp:/var/spool/uucp:/bin/sh proxy:*:13:13:proxy:/bin:/bin/sh www-data:*:33:33:www-data:/var/www:/bin/sh backup:*:34:34:backup:/var/backups:/bin/sh list:*:38:38:Mailing List Manager:/var/list:/bin/sh irc:*:39:39:ircd:/var/run/ircd:/bin/sh gnats:*:41:41:Gnats Bug-Reporting System (admin):/var/lib/gnats:/bin/sh nobody:*:65534:65534:nobody:/nonexistent:/bin/sh 070701002EC7BC000081A400000000000000000000000147CEEAEA00000020000000080000001100000000000000000000000E00000000etc/issue.netOpenedHand Linux (Poky) 3.1 %h 070701002EC866000081A400000000000000000000000147CEEAEA000009AE000000080000001100000000000000000000000E00000000etc/protocols# Internet (IP) protocols # # Updated from http://www.iana.org/assignments/protocol-numbers and other # sources. # New protocols will be added on request if they have been officially # assigned by IANA and are not historical. # If you need a huge list of used numbers please install the nmap package. ip 0 IP # internet protocol, pseudo protocol number #hopopt 0 HOPOPT # IPv6 Hop-by-Hop Option [RFC1883] icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway (Cisco) pup 12 PUP # PARC universal packet protocol udp 17 UDP # user datagram protocol hmp 20 HMP # host monitoring protocol xns-idp 22 XNS-IDP # Xerox NS IDP rdp 27 RDP # "reliable datagram" protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 [RFC905] xtp 36 XTP # Xpress Transfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport ipv6 41 IPv6 # Internet Protocol, version 6 ipv6-route 43 IPv6-Route # Routing Header for IPv6 ipv6-frag 44 IPv6-Frag # Fragment Header for IPv6 idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation esp 50 IPSEC-ESP # Encap Security Payload [RFC2046] ah 51 IPSEC-AH # Authentication Header [RFC2402] skip 57 SKIP # SKIP ipv6-icmp 58 IPv6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPv6-NoNxt # No Next Header for IPv6 ipv6-opts 60 IPv6-Opts # Destination Options for IPv6 rspf 73 RSPF CPHB # Radio Shortest Path First (officially CPHB) vmtp 81 VMTP # Versatile Message Transport eigrp 88 EIGRP # Enhanced Interior Routing Protocol (Cisco) ospf 89 OSPFIGP # Open Shortest Path First IGP ax.25 93 AX.25 # AX.25 frames ipip 94 IPIP # IP-within-IP Encapsulation Protocol etherip 97 ETHERIP # Ethernet-within-IP Encapsulation [RFC3378] encap 98 ENCAP # Yet Another IP encapsulation [RFC1241] # 99 # any private encryption scheme pim 103 PIM # Protocol Independent Multicast ipcomp 108 IPCOMP # IP Payload Compression Protocol vrrp 112 VRRP # Virtual Router Redundancy Protocol l2tp 115 L2TP # Layer Two Tunneling Protocol [RFC2661] isis 124 ISIS # IS-IS over IPv4 sctp 132 SCTP # Stream Control Transmission Protocol fc 133 FC # Fibre Channel 070701002EC818000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000A00000000etc/rc5.d070701002EC8190000A1FF00000000000000000000000147CEFADB00000013000000080000001100000000000000000000001700000000etc/rc5.d/S99rmnologin../init.d/rmnologin070701002ECDEC0000A1FF00000000000000000000000147CEFAFD00000010000000080000001100000000000000000000001400000000etc/rc5.d/S20syslog../init.d/syslog070701002EC7BD000041ED00000000000000000000000347CEFADB00000000000000080000001100000000000000000000000C00000000etc/default070701002EC88F000081A400000000000000000000000147CEEAEF000002D3000000080000001100000000000000000000001000000000etc/default/rcS# # Defaults for the boot scripts in /etc/rcS.d # # Time files in /tmp are kept in days. TMPTIME=0 # Set to yes if you want sulogin to be spawned on bootup SULOGIN=no # Set to no if you want to be able to login over telnet/rlogin # before system startup is complete (as soon as inetd is started) DELAYLOGIN=no # Set UTC=yes if your system clock is set to UTC (GMT), and UTC=no if not. # UTC=yes # Set VERBOSE to "no" if you would like a more quiet bootup. VERBOSE=no # Set EDITMOTD to "no" if you don't want /etc/motd to be editted automatically EDITMOTD=no # Set FSCKFIX to "yes" if you want to add "-y" to the fsck at startup. FSCKFIX=yes # Set TICKADJ to the correct tick value for this specific machine #TICKADJ=10000 070701002EC81A000041ED00000000000000000000000247CEFADB00000000000000080000001100000000000000000000001600000000etc/default/volatiles070701002EC81B000081A400000000000000000000000147CEEAEA000005F7000000080000001100000000000000000000001E00000000etc/default/volatiles/00_core# This configuration file lists filesystem objects that should get verified # during startup and be created if missing. # # Every line must either be a comment starting with # # or a definition of format: # [] # where the items are separated by whitespace ! # # : d|f|l : (d)irectory|(f)ile|(l)ink # # A linking example: # l root root 0777 /var/test /tmp/testfile # f root root 0644 /var/test # # Understanding links: # When populate-volatile is to verify/create a directory or file, it will first # check it's existence. If a link is found to exist in the place of the target, # the path of the target is replaced with the target the link points to. # Thus, if a link is in the place to be verified, the object will be created # in the place the link points to instead. # This explains the order of "link before object" as in the example above, where # a link will be created at /var/test pointing to /tmp/testfile and due to this # link the file defined as /var/test will actually be created as /tmp/testfile. d root root 0775 /var d root root 0755 /var/backups d root root 0755 /var/cache d root root 0755 /var/lib d root root 0755 /var/lib/ipkg d root root 0755 /var/lib/misc d root root 2775 /var/local d root root 1777 /var/lock d root root 0755 /var/lock/subsys d root root 0755 /var/log d root root 0755 /var/run d root root 0755 /var/spool d root root 1777 /var/tmp f root root 0664 /var/run/utmp f root root 0664 /var/log/wtmp f root root 0664 /var/log/lastlog 070701002EC7BE000081A400000000000000000000000147CEEAEA00000000000000080000001100000000000000000000001100000000etc/default/usbd070701002EC81C000081ED00000000000000000000000147CEEAEA0000005D000000080000001100000000000000000000001300000000etc/default/devpts# GID of the `tty' group TTYGRP=5 # Set to 600 to have `mesg n' be the default TTYMODE=620 070701002EC8F5000081A400000000000000000000000147CEFADB000001CD000000080000001100000000000000000000000A00000000etc/grouproot:*:0: daemon:*:1: bin:*:2: sys:*:3: adm:*:4: tty:*:5: disk:*:6: lp:*:7: mail:*:8: news:*:9: uucp:*:10: man:*:12: proxy:*:13: kmem:*:15: dialout:*:20: fax:*:21: voice:*:22: cdrom:*:24: floppy:*:25: tape:*:26: sudo:*:27: audio:*:29: dip:*:30: www-data:*:33: backup:*:34: operator:*:37: list:*:38: irc:*:39: src:*:40: gnats:*:41: shadow:*:42: utmp:*:43: video:*:44: sasl:*:45: plugdev:*:46: staff:*:50: games:*:60: users:*:100: mysql:*:64001: nogroup:*:65534: 070701002EC867000081A400000000000000000000000147CEEAEA000044A3000000080000001100000000000000000000000D00000000etc/services# Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, officially ports have two entries # even if the protocol doesn't support UDP operations. # # Updated from http://www.iana.org/assignments/port-numbers and other # sources like http://www.freebsd.org/cgi/cvsweb.cgi/src/etc/services . # New ports will be added on request if they have been officially assigned # by IANA and used in the real-world or are needed by a debian package. # If you need a huge list of used numbers please install the nmap package. tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp ftp 21/tcp fsp 21/udp fspd ssh 22/tcp # SSH Remote Login Protocol ssh 22/udp telnet 23/tcp smtp 25/tcp mail time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname tacacs 49/tcp # Login Host Protocol (TACACS) tacacs 49/udp re-mail-ck 50/tcp # Remote Mail Checking Protocol re-mail-ck 50/udp domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated tacacs-ds 65/tcp # TACACS-Database Service tacacs-ds 65/udp bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink kerberos 88/tcp kerberos5 krb5 kerberos-sec # Kerberos v5 kerberos 88/udp kerberos5 krb5 kerberos-sec # Kerberos v5 supdup 95/tcp hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE acr-nema 104/tcp dicom # Digital Imag. & Comm. 300 acr-nema 104/udp dicom # Digital Imag. & Comm. 300 csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice pop-2 # POP version 2 pop2 109/udp pop-2 pop3 110/tcp pop-3 # POP version 3 pop3 110/udp pop-3 sunrpc 111/tcp portmapper # RPC 4.0 portmapper sunrpc 111/udp portmapper auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol pwdgen 129/tcp # PWDGEN service pwdgen 129/udp # PWDGEN service loc-srv 135/tcp epmap # Location Service loc-srv 135/udp epmap netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap2 143/tcp imap # Interim Mail Access P 2 and 4 imap2 143/udp imap snmp 161/tcp # Simple Net Mgmt Protocol snmp 161/udp # Simple Net Mgmt Protocol snmp-trap 162/tcp snmptrap # Traps for SNMP snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp mailq 174/tcp # Mailer transport queue for Zmailer mailq 174/udp # Mailer transport queue for Zmailer xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Protocol bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp qmtp 209/tcp # Quick Mail Transfer Protocol qmtp 209/udp # Quick Mail Transfer Protocol z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 pawserv 345/tcp # Perf Analysis Workbench pawserv 345/udp zserv 346/tcp # Zebra server zserv 346/udp fatserv 347/tcp # Fatmen Server fatserv 347/udp rpc2portmap 369/tcp rpc2portmap 369/udp # Coda portmapper codaauth2 370/tcp codaauth2 370/udp # Coda authentication server clearcase 371/tcp Clearcase clearcase 371/udp Clearcase ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp ldap 389/tcp # Lightweight Directory Access Protocol ldap 389/udp imsp 406/tcp # Interactive Mail Support Protocol imsp 406/udp https 443/tcp # http protocol over TLS/SSL https 443/udp snpp 444/tcp # Simple Network Paging Protocol snpp 444/udp microsoft-ds 445/tcp # Microsoft Naked CIFS microsoft-ds 445/udp saft 487/tcp # Simple Asynchronous File Transfer saft 487/udp isakmp 500/tcp # IPsec - Internet Security Association isakmp 500/udp # and Key Management Protocol rtsp 554/tcp # Real Time Stream Control Protocol rtsp 554/udp # Real Time Stream Control Protocol nqs 607/tcp # Network Queuing system nqs 607/udp npmp-local 610/tcp dqs313_qmaster # npmp-local / DQS npmp-local 610/udp dqs313_qmaster npmp-gui 611/tcp dqs313_execd # npmp-gui / DQS npmp-gui 611/udp dqs313_execd hmmp-ind 612/tcp dqs313_intercell # HMMP Indication / DQS hmmp-ind 612/udp dqs313_intercell ipp 631/tcp # Internet Printing Protocol ipp 631/udp # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # for emergency broadcasts gdomap 538/tcp # GNUstep distributed objects gdomap 538/udp uucp 540/tcp uucpd # uucp daemon klogin 543/tcp # Kerberized `rlogin' (v5) kshell 544/tcp krcmd # Kerberized `rsh' (v5) afpovertcp 548/tcp # AFP over TCP afpovertcp 548/udp remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem nntps 563/tcp snntp # NNTP over SSL nntps 563/udp snntp submission 587/tcp # Submission [RFC2476] submission 587/udp ldaps 636/tcp # LDAP over SSL ldaps 636/udp tinc 655/tcp # tinc control port tinc 655/udp silc 706/tcp silc 706/udp kerberos-adm 749/tcp # Kerberos `kadmin' (v5) # webster 765/tcp # Network dictionary webster 765/udp rsync 873/tcp rsync 873/udp ftps-data 989/tcp # FTP over SSL (data) ftps 990/tcp telnets 992/tcp # Telnet over SSL telnets 992/udp imaps 993/tcp # IMAP over SSL imaps 993/udp ircs 994/tcp # IRC over SSL ircs 994/udp pop3s 995/tcp # POP-3 over SSL pop3s 995/udp # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # socks 1080/tcp # socks proxy server socks 1080/udp proofd 1093/tcp proofd 1093/udp rootd 1094/tcp rootd 1094/udp openvpn 1194/tcp openvpn 1194/udp rmiregistry 1099/tcp # Java RMI Registry rmiregistry 1099/udp kazaa 1214/tcp kazaa 1214/udp nessus 1241/tcp # Nessus vulnerability nessus 1241/udp # assessment scanner lotusnote 1352/tcp lotusnotes # Lotus Note lotusnote 1352/udp lotusnotes ms-sql-s 1433/tcp # Microsoft SQL Server ms-sql-s 1433/udp ms-sql-m 1434/tcp # Microsoft SQL Monitor ms-sql-m 1434/udp ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp datametrics 1645/tcp old-radius datametrics 1645/udp old-radius sa-msg-port 1646/tcp old-radacct sa-msg-port 1646/udp old-radacct kermit 1649/tcp kermit 1649/udp l2f 1701/tcp l2tp l2f 1701/udp l2tp radius 1812/tcp radius 1812/udp radius-acct 1813/tcp radacct # Radius Accounting radius-acct 1813/udp radacct unix-status 1957/tcp # remstats unix-status server log-server 1958/tcp # remstats log server remoteping 1959/tcp # remstats remoteping server rtcm-sc104 2101/tcp # RTCM SC-104 IANA 1/29/99 rtcm-sc104 2101/udp cvspserver 2401/tcp # CVS client/server operations cvspserver 2401/udp venus 2430/tcp # codacon port venus 2430/udp # Venus callback/wbc interface venus-se 2431/tcp # tcp side effects venus-se 2431/udp # udp sftp side effect codasrv 2432/tcp # not used codasrv 2432/udp # server port codasrv-se 2433/tcp # tcp side effects codasrv-se 2433/udp # udp sftp side effect mon 2583/tcp # MON mon 2583/udp dict 2628/tcp # Dictionary server dict 2628/udp gpsd 2947/tcp gpsd 2947/udp gds_db 3050/tcp # InterBase server gds_db 3050/udp icpv2 3130/tcp icp # Internet Cache Protocol icpv2 3130/udp icp mysql 3306/tcp mysql 3306/udp nut 3493/tcp # Network UPS Tools nut 3493/udp distcc 3632/tcp # distributed compiler distcc 3632/udp daap 3689/tcp # Digital Audio Access Protocol daap 3689/udp svn 3690/tcp subversion # Subversion protocol svn 3690/udp subversion iax 4569/tcp # Inter-Asterisk eXchange iax 4569/udp radmin-port 4899/tcp # RAdmin Port radmin-port 4899/udp rfe 5002/udp # Radio Free Ethernet rfe 5002/tcp sip 5060/tcp # Session Initiation Protocol sip 5060/udp sip-tls 5061/tcp sip-tls 5061/udp xmpp-client 5222/tcp jabber-client # Jabber Client Connection xmpp-client 5222/udp jabber-client xmpp-server 5269/tcp jabber-server # Jabber Server Connection xmpp-server 5269/udp jabber-server cfengine 5308/tcp cfengine 5308/udp postgresql 5432/tcp postgres # PostgreSQL Database postgresql 5432/udp postgres x11 6000/tcp x11-0 # X Window System x11 6000/udp x11-0 x11-1 6001/tcp x11-1 6001/udp x11-2 6002/tcp x11-2 6002/udp x11-3 6003/tcp x11-3 6003/udp x11-4 6004/tcp x11-4 6004/udp x11-5 6005/tcp x11-5 6005/udp x11-6 6006/tcp x11-6 6006/udp x11-7 6007/tcp x11-7 6007/udp gnutella-svc 6346/tcp # gnutella gnutella-svc 6346/udp gnutella-rtr 6347/tcp # gnutella gnutella-rtr 6347/udp afs3-fileserver 7000/tcp bbs # file server itself afs3-fileserver 7000/udp bbs afs3-callback 7001/tcp # callbacks to cache managers afs3-callback 7001/udp afs3-prserver 7002/tcp # users & groups database afs3-prserver 7002/udp afs3-vlserver 7003/tcp # volume location database afs3-vlserver 7003/udp afs3-kaserver 7004/tcp # AFS/Kerberos authentication afs3-kaserver 7004/udp afs3-volser 7005/tcp # volume managment server afs3-volser 7005/udp afs3-errors 7006/tcp # error interpretation service afs3-errors 7006/udp afs3-bos 7007/tcp # basic overseer process afs3-bos 7007/udp afs3-update 7008/tcp # server-to-server updater afs3-update 7008/udp afs3-rmtsys 7009/tcp # remote cache manager service afs3-rmtsys 7009/udp font-service 7100/tcp xfs # X Font Service font-service 7100/udp xfs bacula-dir 9101/tcp # Bacula Director bacula-dir 9101/udp bacula-fd 9102/tcp # Bacula File Daemon bacula-fd 9102/udp bacula-sd 9103/tcp # Bacula Storage Daemon bacula-sd 9103/udp amanda 10080/tcp # amanda backup services amanda 10080/udp hkp 11371/tcp # OpenPGP HTTP Keyserver hkp 11371/udp # OpenPGP HTTP Keyserver bprd 13720/tcp # VERITAS NetBackup bprd 13720/udp bpdbm 13721/tcp # VERITAS NetBackup bpdbm 13721/udp bpjava-msvc 13722/tcp # BP Java MSVC Protocol bpjava-msvc 13722/udp vnetd 13724/tcp # Veritas Network Utility vnetd 13724/udp bpcd 13782/tcp # VERITAS NetBackup bpcd 13782/udp vopied 13783/tcp # VERITAS NetBackup vopied 13783/udp wnn6 22273/tcp # wnn6 wnn6 22273/udp # # Datagram Delivery Protocol services # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol #========================================================================= # The remaining port numbers are not as allocated by IANA. #========================================================================= # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v4 should uncomment these and comment out the v5 entries above. # kerberos4 750/udp kerberos-iv kdc # Kerberos (server) kerberos4 750/tcp kerberos-iv kdc kerberos_master 751/udp # Kerberos authentication kerberos_master 751/tcp passwd_server 752/udp # Kerberos passwd server krb_prop 754/tcp krb5_prop hprop # Kerberos slave propagation krbupdate 760/tcp kreg # Kerberos registration kpasswd 761/tcp kpwd # Kerberos "passwd" swat 901/tcp # swat kpop 1109/tcp # Pop with Kerberos knetd 2053/tcp # Kerberos de-multiplexor zephyr-srv 2102/udp # Zephyr server zephyr-clt 2103/udp # Zephyr serv-hm connection zephyr-hm 2104/udp # Zephyr hostmanager eklogin 2105/tcp # Kerberos encrypted rlogin # Hmmm. Are we using Kv4 or Kv5 now? Worrying. # The following is probably Kerberos v5 --- ajt@debian.org (11/02/2000) kx 2111/tcp # X over Kerberos iprop 2121/tcp # incremental propagation # # Unofficial but necessary (for NetBSD) services # supfilesrv 871/tcp # SUP server supfiledbg 1127/tcp # SUP debugging # # Services added for the Debian GNU/Linux distribution # linuxconf 98/tcp # LinuxConf poppassd 106/tcp # Eudora poppassd 106/udp ssmtp 465/tcp smtps # SMTP over SSL moira_db 775/tcp # Moira database moira_update 777/tcp # Moira update protocol moira_ureg 779/udp # Moira user registration spamd 783/tcp # spamassassin daemon omirr 808/tcp omirrd # online mirror omirr 808/udp omirrd customs 1001/tcp # pmake customs server customs 1001/udp skkserv 1178/tcp # skk jisho server port predict 1210/udp # predict -- satellite tracking rmtcfg 1236/tcp # Gracilis Packeten remote config server wipld 1300/tcp # Wipl network monitor xtel 1313/tcp # french minitel xtelw 1314/tcp # french minitel support 1529/tcp # GNATS sieve 2000/tcp # Sieve mail filter daemon cfinger 2003/tcp # GNU Finger ndtp 2010/tcp # Network dictionary transfer protocol frox 2121/tcp # frox: caching ftp proxy ninstall 2150/tcp # ninstall service ninstall 2150/udp zebrasrv 2600/tcp # zebra service zebra 2601/tcp # zebra vty ripd 2602/tcp # ripd vty (zebra) ripngd 2603/tcp # ripngd vty (zebra) ospfd 2604/tcp # ospfd vty (zebra) bgpd 2605/tcp # bgpd vty (zebra) ospf6d 2606/tcp # ospf6d vty (zebra) ospfapi 2607/tcp # OSPF-API isisd 2608/tcp # ISISd vty (zebra) afbackup 2988/tcp # Afbackup system afbackup 2988/udp afmbackup 2989/tcp # Afmbackup system afmbackup 2989/udp xtell 4224/tcp # xtell server fax 4557/tcp # FAX transmission service (old) hylafax 4559/tcp # HylaFAX client-server protocol (new) distmp3 4600/tcp # distmp3host daemon munin 4949/tcp lrrd # Munin enbd-cstatd 5051/tcp # ENBD client statd enbd-sstatd 5052/tcp # ENBD server statd pcrd 5151/tcp # PCR-1000 Daemon noclog 5354/tcp # noclogd with TCP (nocol) noclog 5354/udp # noclogd with UDP (nocol) hostmon 5355/tcp # hostmon uses TCP (nocol) hostmon 5355/udp # hostmon uses UDP (nocol) rplay 5555/udp # RPlay audio service rplay 5555/tcp rptp 5556/udp # Remote Play Transfer Protocol rptp 5556/tcp nsca 5667/tcp # Nagios Agent - NSCA mrtd 5674/tcp # MRT Routing Daemon bgpsim 5675/tcp # MRT Routing Simulator canna 5680/tcp # cannaserver sane-port 6566/tcp sane saned # SANE network scanner daemon ircd 6667/tcp # Internet Relay Chat zope-ftp 8021/tcp # zope management by ftp webcache 8080/tcp # WWW caching service tproxy 8081/tcp # Transparent Proxy omniorb 8088/tcp # OmniORB omniorb 8088/udp clc-build-daemon 8990/tcp # Common lisp build daemon xinetd 9098/tcp mandelspawn 9359/udp mandelbrot # network mandelbrot zope 9673/tcp # zope server kamanda 10081/tcp # amanda backup services (Kerberos) kamanda 10081/udp amandaidx 10082/tcp # amanda backup services amidxtape 10083/tcp # amanda backup services smsqp 11201/tcp # Alamin SMS gateway smsqp 11201/udp xpilot 15345/tcp # XPilot Contact Port xpilot 15345/udp sgi-cmsd 17001/udp # Cluster membership services daemon sgi-crsd 17002/udp sgi-gcd 17003/udp # SGI Group membership daemon sgi-cad 17004/tcp # Cluster Admin daemon isdnlog 20011/tcp # isdn logging system isdnlog 20011/udp vboxd 20012/tcp # voice box system vboxd 20012/udp binkp 24554/tcp # binkp fidonet protocol asp 27374/tcp # Address Search Protocol asp 27374/udp dircproxy 57000/tcp # Detachable IRC Proxy tfido 60177/tcp # fidonet EMSI over telnet fido 60179/tcp # fidonet EMSI over TCP # Local services 070701002EC7BF000081A400000000000000000000000147CEEAEA000001D1000000080000001100000000000000000000001200000000etc/nsswitch.conf# /etc/nsswitch.conf # # Example configuration of GNU Name Service Switch functionality. # If you have the `glibc-doc' and `info' packages installed, try: # `info libc "Name Service Switch"' for information about this file. passwd: compat group: compat shadow: compat hosts: files dns networks: files protocols: db files services: db files ethers: db files rpc: db files netgroup: nis 070701002EC8B8000041ED00000000000000000000000447CEFADB00000000000000080000001100000000000000000000000900000000etc/udev070701002EC8B9000081A400000000000000000000000147CEEB6100000021000000080000001100000000000000000000001900000000etc/udev/mount.blacklist/dev/loop /dev/ram /dev/mtdblock 070701002EC8BA000041ED00000000000000000000000247CEFADB00000000000000080000001100000000000000000000001100000000etc/udev/scripts070701002EC8BB000081ED00000000000000000000000147CEEB6100000640000000080000001100000000000000000000001A00000000etc/udev/scripts/mount.sh#!/bin/sh # # Called from udev # Attemp to mount any added block devices # and remove any removed devices # MOUNT="/bin/mount" PMOUNT="/usr/bin/pmount" UMOUNT="/bin/umount" name="`basename "$DEVNAME"`" for line in `cat /etc/udev/mount.blacklist | grep -v ^#` do if ( echo "$DEVNAME" | grep -q "$line" ) then logger "udev/mount.sh" "[$DEVNAME] is blacklisted, ignoring" exit 0 fi done automount() { ! test -d "/media/$name" && mkdir -p "/media/$name" if ! $MOUNT -t auto -o sync $DEVNAME "/media/$name" then #logger "mount.sh/automount" "$MOUNT -t auto $DEVNAME \"/media/$name\" failed!" rm_dir "/media/$name" else logger "mount.sh/automount" "Auto-mount of [/media/$name] successful" touch "/tmp/.automount-$name" fi } rm_dir() { # We do not want to rm -r populated directories if test "`find "$1" | wc -l | tr -d " "`" -lt 2 -a -d "$1" then ! test -z "$1" && rm -r "$1" else logger "mount.sh/automount" "Not removing non-empty directory [$1]" fi } if [ "$ACTION" = "add" ] && [ -n "$DEVNAME" ]; then if [ -x "$PMOUNT" ]; then $PMOUNT $DEVNAME 2> /dev/null elif [ -x $MOUNT ]; then $MOUNT $DEVNAME 2> /dev/null fi # If the device isn't mounted at this point, it isn't configured in fstab cat /proc/mounts | awk '{print $1}' | grep -q "^$DEVNAME$" || automount fi if [ "$ACTION" = "remove" ] && [ -x "$UMOUNT" ] && [ -n "$DEVNAME" ]; then for mnt in `cat /proc/mounts | grep "$DEVNAME" | cut -f 2 -d " " ` do $UMOUNT $mnt done # Remove empty directories from auto-mounter test -e "/tmp/.automount-$name" && rm_dir "/media/$name" fi 070701002EC8BC000081ED00000000000000000000000147CEEB6100000580000000080000001100000000000000000000001C00000000etc/udev/scripts/network.sh#!/bin/sh # Do not run when pcmcia-cs is installed test -x /sbin/cardctl && exit 0 # We get two "add" events for hostap cards due to wifi0 echo "$INTERFACE" | grep -q wifi && exit 0 # Check if /etc/init.d/network has been run yet to see if we are # called by starting /etc/rcS.d/S03udev and not by hotplugging a device # # At this stage, network interfaces should not be brought up # automatically because: # a) /etc/init.d/network has not been run yet (security issue) # b) /var has not been populated yet so /etc/resolv,conf points to # oblivion, making the network unusable # spoofp="`grep ^spoofprotect /etc/network/options`" if test -z "$spoofp" then # This is the default from /etc/init.d/network spoofp_val=yes else spoofp_val=${spoofp#spoofprotect=} fi test "$spoofp_val" = yes && spoofp_val=1 || spoofp_val=0 # I think it is safe to assume that "lo" will always be there ;) if test "`cat /proc/sys/net/ipv4/conf/lo/rp_filter`" != "$spoofp_val" -a -n "$spoofp_val" then echo "$INTERFACE" >> /dev/udev_network_queue exit 0 fi # # Code taken from pcmcia-cs:/etc/pcmcia/network # # if this interface has an entry in /etc/network/interfaces, let ifupdown # handle it if grep -q "iface \+$INTERFACE" /etc/network/interfaces; then case $ACTION in add) ifconfig | grep -q "^$INTERFACE" || ifup $INTERFACE ;; remove) ifdown $INTERFACE ;; esac exit 0 fi 070701002EC8BD000081A400000000000000000000000147CEEB61000001A0000000080000001100000000000000000000001400000000etc/udev/links.conf# This file does not exist. Please do not ask the debian maintainer about it. # You may use it to do strange and wonderful things, at your risk. L fd /proc/self/fd L stdin /proc/self/fd/0 L stdout /proc/self/fd/1 L stderr /proc/self/fd/2 L core /proc/kcore L sndstat /proc/asound/oss/sndstat L MAKEDEV /sbin/MAKEDEV D pts D shm # Hic sunt leones. M ppp c 108 0 D loop M loop/0 b 7 0 D net M net/tun c 10 200 070701002EC8BE000041ED00000000000000000000000247CEFADB00000000000000080000001100000000000000000000001100000000etc/udev/rules.d070701002EC8BF000081A400000000000000000000000147CEEB61000000BF000000080000001100000000000000000000002500000000etc/udev/rules.d/05-udev-early.rules# do not edit this file, it will be overwritten on update # sysfs is populated after the event is sent ACTION=="add", KERNEL=="[0-9]*:[0-9]*", SUBSYSTEM=="scsi", WAIT_FOR_SYSFS="ioerr_cnt" 070701002EC8C0000081A400000000000000000000000147CEEB6100000273000000080000001100000000000000000000002200000000etc/udev/rules.d/80-drivers.rules# do not edit this file, it will be overwritten on update ACTION!="add", GOTO="drivers_end" DRIVER!="?*", ENV{MODALIAS}=="?*", RUN{ignore_error}+="/sbin/modprobe $env{MODALIAS}" SUBSYSTEM=="pnp", DRIVER!="?*", ENV{MODALIAS}!="?*", \ RUN{ignore_error}+="/bin/sh -c '/sbin/modprobe -a $$(while read id; do echo pnp:d$$id; done < /sys$devpath/id)'" SUBSYSTEM=="tifm", RUN+="/sbin/modprobe --all tifm_sd tifm_ms" SUBSYSTEM=="mmc", RUN+="/sbin/modprobe mmc_block" SUBSYSTEM=="ide", ATTR{media}=="tape", RUN+="/sbin/modprobe ide-scsi" SUBSYSTEM=="scsi_device", TEST!="[module/sg]", RUN+="/sbin/modprobe sg" LABEL="drivers_end" 070701002EC8C1000081A400000000000000000000000147CEEB6100000FF0000000080000001100000000000000000000002D00000000etc/udev/rules.d/60-persistent-storage.rules# do not edit this file, it will be overwritten on update # persistent storage links: /dev/{disk,tape}/{by-id,by-uuid,by-label,by-path,by-name} # scheme based on "Linux persistent device names", 2004, Hannes Reinecke ACTION!="add", GOTO="persistent_storage_end" KERNEL=="nst[0-9]", SUBSYSTEMS=="scsi", IMPORT{program}="scsi_id --export --whitelisted --fallback-to-sysfs -s %p -d $tempnode", SYMLINK+="tape/by-id/$env{ID_BUS}-$env{ID_SERIAL}-nst" # type 8 devices are "Medium Changers" KERNEL=="sg*", SUBSYSTEMS=="scsi", ATTRS{type}=="8", IMPORT{program}="scsi_id --export --whitelisted --fallback-to-sysfs -s %p -d $tempnode", SYMLINK+="tape/by-id/$env{ID_BUS}-$env{ID_SERIAL}" SUBSYSTEM!="block", GOTO="persistent_storage_end" # skip rules for inappropriate block devices KERNEL=="ram*|loop*|fd*|nbd*|gnbd*|dm-*|md*", GOTO="persistent_storage_end" # never access non-cdrom removable ide devices, the drivers are causing event loops on open() KERNEL=="hd*[!0-9]", ATTR{removable}=="1", DRIVERS=="ide-cs|ide-floppy", GOTO="persistent_storage_end" KERNEL=="hd*[0-9]", ATTRS{removable}=="1", GOTO="persistent_storage_end" # ignore partitions that span the entire disk ATTR{whole_disk}=="*", GOTO="persistent_storage_end" # /sys/class/block will export this ENV{DEVTYPE}!="?*", ATTR{range}=="?*", ENV{DEVTYPE}="disk" ENV{DEVTYPE}!="?*", ATTR{start}=="?*", ENV{DEVTYPE}="partition" # for partitions import parent information ENV{DEVTYPE}=="partition", IMPORT{parent}="ID_*" # by-id (hardware serial number) KERNEL=="hd*[!0-9]", IMPORT{program}="ata_id --export $tempnode" KERNEL=="hd*[!0-9]", ENV{ID_SERIAL}=="?*", SYMLINK+="disk/by-id/ata-$env{ID_MODEL}_$env{ID_SERIAL}" KERNEL=="hd*[0-9]", ENV{ID_SERIAL}=="?*", SYMLINK+="disk/by-id/ata-$env{ID_MODEL}_$env{ID_SERIAL}-part%n" KERNEL=="sd*[!0-9]|sr*|st*", ATTRS{ieee1394_id}=="?*", ENV{ID_SERIAL}="$attr{ieee1394_id}", ENV{ID_BUS}="ieee1394" KERNEL=="sd*[!0-9]|sr*|st*", ENV{ID_SERIAL}!="?*", IMPORT{program}="usb_id --export %p" KERNEL=="sd*[!0-9]|sr*|st*", ENV{ID_SERIAL}!="?*", IMPORT{program}="scsi_id --export --whitelisted --fallback-to-sysfs -s %p -d $tempnode" KERNEL=="cciss?c[0-9]d[0-9]", ENV{ID_SERIAL}!="?*", IMPORT{program}="scsi_id --export --whitelisted --ignore-sysfs -s %p -d $tempnode", ENV{ID_BUS}="cciss" KERNEL=="sd*[!0-9]|sr*|cciss?c[0-9]d[0-9]", ENV{ID_SERIAL}=="?*", SYMLINK+="disk/by-id/$env{ID_BUS}-$env{ID_SERIAL}" KERNEL=="sd*[0-9]|cciss*p[0-9]", ENV{ID_SERIAL}=="?*", SYMLINK+="disk/by-id/$env{ID_BUS}-$env{ID_SERIAL}-part%n" KERNEL=="st*", ENV{ID_SERIAL}=="?*", SYMLINK+="tape/by-id/$env{ID_BUS}-$env{ID_SERIAL}" # libata compat (links like hd*) KERNEL=="sd*[!0-9]|sr*", ENV{ID_VENDOR}=="ATA", PROGRAM="ata_id $tempnode", RESULT=="?*", ENV{ID_ATA_COMPAT}="$result", SYMLINK+="disk/by-id/ata-$env{ID_ATA_COMPAT}" KERNEL=="sd*[0-9]", ENV{ID_ATA_COMPAT}=="?*", SYMLINK+="disk/by-id/ata-$env{ID_ATA_COMPAT}-part%n" KERNEL=="mmcblk[0-9]", SUBSYSTEMS=="mmc", ATTRS{name}=="?*", ATTRS{serial}=="?*", ENV{ID_NAME}="$attr{name}", ENV{ID_SERIAL}="$attr{serial}", SYMLINK+="disk/by-id/mmc-$env{ID_NAME}_$env{ID_SERIAL}" KERNEL=="mmcblk[0-9]p[0-9]", ENV{ID_NAME}=="?*", ENV{ID_SERIAL}=="?*", SYMLINK+="disk/by-id/mmc-$env{ID_NAME}_$env{ID_SERIAL}-part%n" # by-path (shortest physical path) ENV{DEVTYPE}=="disk", IMPORT{program}="path_id %p" ENV{DEVTYPE}=="disk", ENV{ID_PATH}=="?*", SYMLINK+="disk/by-path/$env{ID_PATH}" ENV{DEVTYPE}=="partition", ENV{ID_PATH}=="?*", SYMLINK+="disk/by-path/$env{ID_PATH}-part%n" KERNEL=="st*", ENV{ID_PATH}=="?*", SYMLINK+="tape/by-path/$env{ID_PATH}" KERNEL=="sr*|st*", GOTO="persistent_storage_end" KERNEL=="hd*[!0-9]", ATTR{removable}=="1", GOTO="persistent_storage_end" # by-label/by-uuid (filesystem properties) ENV{DEVTYPE}=="partition", IMPORT{program}="vol_id --export $tempnode" ENV{ID_FS_USAGE}=="filesystem|other|crypto", ENV{ID_FS_UUID_ENC}=="?*", SYMLINK+="disk/by-uuid/$env{ID_FS_UUID_ENC}" ENV{ID_FS_USAGE}=="filesystem|other", ENV{ID_FS_LABEL_ENC}=="?*", SYMLINK+="disk/by-label/$env{ID_FS_LABEL_ENC}" LABEL="persistent_storage_end" 070701002EC8C2000081A400000000000000000000000147CEEB6100000524000000080000001100000000000000000000001D00000000etc/udev/rules.d/local.rules# There are a number of modifiers that are allowed to be used in some # of the different fields. They provide the following subsitutions: # # %n the "kernel number" of the device. # For example, 'sda3' has a "kernel number" of '3' # %e the smallest number for that name which does not matches an existing node # %k the kernel name for the device # %M the kernel major number for the device # %m the kernel minor number for the device # %b the bus id for the device # %c the string returned by the PROGRAM # %s{filename} the content of a sysfs attribute # %% the '%' char itself # # Media automounting SUBSYSTEM=="block", ACTION=="add" RUN+="/etc/udev/scripts/mount.sh" SUBSYSTEM=="block", ACTION=="remove" RUN+="/etc/udev/scripts/mount.sh" # Handle network interface setup SUBSYSTEM=="net", ACTION=="add" RUN+="/etc/udev/scripts/network.sh" SUBSYSTEM=="net", ACTION=="remove" RUN+="/etc/udev/scripts/network.sh" # The first rtc device is symlinked to /dev/rtc KERNEL=="rtc0", SYMLINK+="rtc" # Try and modprobe for drivers for new hardware ACTION=="add", DEVPATH=="/devices/*", ENV{MODALIAS}=="?*", RUN+="/sbin/modprobe $env{MODALIAS}" # Create a symlink to any touchscreen input device SUBSYSTEM=="input", KERNEL=="event[0-9]*", SYSFS{modalias}=="input:*-e0*,3,*a0,1,*18,*", SYMLINK+="input/touchscreen0" 070701002EC8C3000081A400000000000000000000000147CEEB6100000088000000080000001100000000000000000000002400000000etc/udev/rules.d/95-udev-late.rules# do not edit this file, it will be overwritten on update # event to be catched by udevmonitor RUN+="socket:/org/kernel/udev/monitor" 070701002EC8C4000081A400000000000000000000000147CEEB6100000590000000080000001100000000000000000000002B00000000etc/udev/rules.d/60-persistent-input.rules# do not edit this file, it will be overwritten on update ACTION!="add", GOTO="persistent_input_end" SUBSYSTEM!="input", GOTO="persistent_input_end" KERNEL=="input[0-9]*", GOTO="persistent_input_end" # usb devices SUBSYSTEMS=="usb", IMPORT{program}="usb_id --export" SUBSYSTEMS=="usb", ATTRS{bInterfaceClass}=="03", ATTRS{bInterfaceProtocol}=="01", ENV{ID_CLASS}="kbd" SUBSYSTEMS=="usb", ATTRS{bInterfaceClass}=="03", ATTRS{bInterfaceProtocol}=="02", ENV{ID_CLASS}="mouse" # other devices DRIVERS=="pcspkr", ENV{ID_CLASS}="spkr" DRIVERS=="atkbd", ENV{ID_CLASS}="kbd" DRIVERS=="psmouse", ENV{ID_CLASS}="mouse" ATTRS{name}=="*dvb*|*DVB*|* IR *", ENV{ID_CLASS}="ir" ATTRS{modalias}=="input:*-*a[068],*|input:*-*a*,[68],*m*", ATTRS{modalias}!="input:*-*k*14A,*r*", ENV{ID_CLASS}="joystick" # fill empty serial number ENV{ID_CLASS}=="?*", ENV{ID_SERIAL}=="", ENV{ID_SERIAL}="noserial" # by-id links KERNEL=="mouse*|js*", ENV{ID_BUS}=="?*", ENV{ID_CLASS}=="?*", SYMLINK+="input/by-id/$env{ID_BUS}-$env{ID_SERIAL}-$env{ID_CLASS}" KERNEL=="event*", ENV{ID_BUS}=="?*", ENV{ID_CLASS}=="?*", SYMLINK+="input/by-id/$env{ID_BUS}-$env{ID_SERIAL}-event-$env{ID_CLASS}" # by-path IMPORT{program}="path_id %p" ENV{ID_PATH}=="?*", KERNEL=="mouse*|js*", SYMLINK+="input/by-path/$env{ID_PATH}-$env{ID_CLASS}" ENV{ID_PATH}=="?*", KERNEL=="event*", SYMLINK+="input/by-path/$env{ID_PATH}-event-$env{ID_CLASS}" LABEL="persistent_input_end" 070701002EC8C5000081A400000000000000000000000147CEEB6100001034000000080000001100000000000000000000002700000000etc/udev/rules.d/50-udev-default.rules# do not edit this file, it will be overwritten on update KERNEL=="pty[pqrstuvwxyzabcdef][0123456789abcdef]", GROUP="tty", MODE="0660", OPTIONS="last_rule" KERNEL=="tty[pqrstuvwxyzabcdef][0123456789abcdef]", GROUP="tty", MODE="0660", OPTIONS="last_rule" KERNEL=="ptmx", GROUP="tty", MODE="0666", OPTIONS="last_rule" KERNEL=="tty", GROUP="tty", MODE="0666", OPTIONS="last_rule" KERNEL=="tty[0-9]*", GROUP="tty", MODE="0620", OPTIONS="last_rule" KERNEL=="vcs|vcs[0-9]*|vcsa|vcsa[0-9]*", GROUP="tty", OPTIONS="last_rule" KERNEL=="console", MODE="0600", OPTIONS="last_rule" KERNEL=="tty0", SYMLINK+="systty" # serial KERNEL=="tty[A-Z]*|pppox*|ircomm*|noz*", GROUP="uucp" KERNEL=="ppp", MODE="0600", OPTIONS+="ignore_remove" KERNEL=="mwave", NAME="modems/mwave", GROUP="uucp" KERNEL=="hvc*|hvsi*", GROUP="uucp" KERNEL=="lirc0", SYMLINK+="lirc" # mem KERNEL=="null|zero|random", MODE="0666" KERNEL=="null", SYMLINK+="XOR" KERNEL=="mem|kmem|port", GROUP="kmem", MODE="0640" KERNEL=="nvram", GROUP="kmem", MODE="0600" KERNEL=="ram0", SYMLINK+="ramdisk" KERNEL=="ram1", SYMLINK+="ram" KERNEL=="urandom", MODE="0644" KERNEL=="full", MODE="0666" # input KERNEL=="mouse*|mice|event*", NAME="input/%k", MODE="0640" KERNEL=="ts[0-9]*|uinput", NAME="input/%k", MODE="0600" KERNEL=="js[0-9]*", NAME="input/%k", MODE="0644", SYMLINK+="%k" # video4linux KERNEL=="vbi0", SYMLINK+="vbi" KERNEL=="radio0", SYMLINK+="radio" KERNEL=="video0", SYMLINK+="video" # graphics KERNEL=="agpgart", MODE="0600" KERNEL=="card[0-9]*", NAME="dri/%k", MODE="0666" KERNEL=="fb0", SYMLINK+="fb" # DVB video SUBSYSTEM=="dvb", PROGRAM="/bin/sh -c 'K=%k; K=$${K#dvb}; printf dvb/adapter%%i/%%s $${K%%%%.*} $${K#*.}'", NAME="%c" # Firewire KERNEL=="dv1394*", SYMLINK+="dv1394/%n" KERNEL=="video1394*", NAME="video1394/%n" # firmware class requests SUBSYSTEM=="firmware", ACTION=="add", RUN+="firmware.sh" # libusb device nodes SUBSYSTEM=="usb", ACTION=="add", ENV{DEVTYPE}=="usb_device", NAME="bus/usb/$env{BUSNUM}/$env{DEVNUM}", MODE="0644" # printer KERNEL=="parport[0-9]*", GROUP="lp" SUBSYSTEM=="printer", KERNEL=="lp*", GROUP="lp" SUBSYSTEM=="usb", KERNEL=="lp*", NAME="usb/%k", SYMLINK+="usb%k", GROUP="lp" KERNEL=="lp[0-9]*", GROUP="lp" SYMLINK+="par%n" KERNEL=="irlpt[0-9]*", GROUP="lp" # block, tapes, block-releated SUBSYSTEM=="block", GROUP="disk", MODE="0640" SUBSYSTEM=="block", KERNEL=="sr[0-9]*", SYMLINK+="scd%n" SUBSYSTEM=="scsi", KERNEL=="[0-9]*:[0-9]*", ACTION=="add", ATTR{type}=="0|7|14", ATTR{timeout}="60" SUBSYSTEM=="scsi", KERNEL=="[0-9]*:[0-9]*", ACTION=="add", ATTR{type}=="1", ATTR{timeout}="900" KERNEL=="hd*", SUBSYSTEMS=="ide", ATTRS{media}=="floppy", OPTIONS+="all_partitions" KERNEL=="fd[0-9]", GROUP="floppy" KERNEL=="fd[0-9]", ACTION=="add", ATTRS{cmos}=="?*", RUN+="create_floppy_devices -c -t $attr{cmos} -m %M -M 0640 -G floppy $root/%k" KERNEL=="sch[0-9]*", GROUP="disk" KERNEL=="sg[0-9]*", GROUP="disk", MODE="0640" KERNEL=="ht[0-9]*|nht[0-9]*", GROUP="disk"" KERNEL=="pg[0-9]*", GROUP="disk" KERNEL=="pt[0-9]*|npt[0-9]*", GROUP="disk" KERNEL=="qft[0-9]*|nqft[0-9]*|zqft[0-9]*|nzqft[0-9]*|rawqft[0-9]*|nrawqft[0-9]*", GROUP="disk" KERNEL=="rawctl", NAME="raw/%k", GROUP="disk" SUBSYSTEM=="raw", KERNEL=="raw[0-9]*", NAME="raw/%k", GROUP="disk" KERNEL=="pktcdvd[0-9]*", NAME="pktcdvd/%k" KERNEL=="pktcdvd", NAME="pktcdvd/control" KERNEL=="qft0", SYMLINK+="ftape" # network KERNEL=="tun", NAME="net/%k", MODE="0666", OPTIONS+="ignore_remove" # CPU KERNEL=="cpu[0-9]*", NAME="cpu/%n/cpuid" KERNEL=="msr[0-9]*", NAME="cpu/%n/msr" KERNEL=="microcode", NAME="cpu/microcode", MODE="0600" # miscellaneous KERNEL=="fuse", MODE="0666" KERNEL=="rtc", MODE="0644" KERNEL=="auer[0-9]*" NAME="usb/%k" KERNEL=="hw_random", NAME="hwrng", SYMLINK+="%k" KERNEL=="mmtimer", MODE="0644" KERNEL=="rflash[0-9]*", MODE="0400" KERNEL=="rrom[0-9]*", MODE="0400" KERNEL=="sbpcd0", SYMLINK+="sbpcd" KERNEL=="slram[0-9]*", SYMLINK+="xpram%n" KERNEL=="sxctl", NAME="specialix_sxctl", SYMLINK+="%k" KERNEL=="rioctl", NAME="specialix_rioctl", SYMLINK+="%k" KERNEL=="iowarrior[0-9]*", NAME="usb/%k" 070701002EC8C6000081A400000000000000000000000147CEEB6100000D07000000080000001100000000000000000000001C00000000etc/udev/rules.d/udev.rules# There are a number of modifiers that are allowed to be used in some # of the different fields. They provide the following subsitutions: # # %n the "kernel number" of the device. # For example, 'sda3' has a "kernel number" of '3' # %e the smallest number for that name which does not matches an existing node # %k the kernel name for the device # %M the kernel major number for the device # %m the kernel minor number for the device # %b the bus id for the device # %c the string returned by the PROGRAM # %s{filename} the content of a sysfs attribute # %% the '%' char itself # # SCSI devices BUS=="scsi", KERNEL=="sr[0-9]*", NAME="scd%n", SYMLINK+="sr%n" # USB devices BUS=="usb", KERNEL=="auer[0-9]*", NAME="usb/%k" BUS=="usb", KERNEL=="cpad[0-9]*", NAME="usb/%k" BUS=="usb", KERNEL=="dabusb*", NAME="usb/%k" BUS=="usb", KERNEL=="hiddev*", NAME="usb/%k" BUS=="usb", KERNEL=="legousbtower*", NAME="usb/%k" BUS=="usb", KERNEL=="lp[0-9]*", NAME="usb/%k" BUS=="usb", KERNEL=="ttyUSB*", SYSFS{product}=="Palm Handheld*", \ SYMLINK+="pilot" # usbfs-like devices SUBSYSTEM=="usb_device", \ PROGRAM="/bin/sh -c 'export X=%k; export X=$${X#usbdev}; export B=$${X%%%%.*}; export D=$${X#*.}; echo bus/usb/$$B/$$D'", SYMLINK+="%c" # serial devices KERNEL=="capi", NAME="capi20", SYMLINK+="isdn/capi20" KERNEL=="capi[0-9]*", NAME="capi/%n" # video devices KERNEL=="card[0-9]*", NAME="dri/%k" # misc devices KERNEL=="hw_random", NAME="hwrng" KERNEL=="tun", NAME="net/%k" KERNEL=="cdemu[0-9]*", NAME="cdemu/%n" KERNEL=="pktcdvd[0-9]*", NAME="pktcdvd/%n" KERNEL=="pktcdvd", NAME="pktcdvd/control" KERNEL=="cpu[0-9]*", NAME="cpu/%n/cpuid" KERNEL=="msr[0-9]*", NAME="cpu/%n/msr" KERNEL=="microcode", NAME="cpu/microcode" KERNEL=="umad*", NAME="infiniband/%k" KERNEL=="issm*", NAME="infiniband/%k" KERNEL=="uverbs*", NAME="infiniband/%k" KERNEL=="ucm", NAME="infiniband/%k" KERNEL=="buzzer", NAME="misc/buzzer" # ALSA devices KERNEL=="controlC[0-9]*", NAME="snd/%k" KERNEL=="hwC[D0-9]*", NAME="snd/%k" KERNEL=="pcmC[D0-9cp]*", NAME="snd/%k" KERNEL=="midiC[D0-9]*", NAME="snd/%k" KERNEL=="timer", NAME="snd/%k" KERNEL=="seq", NAME="snd/%k" # ieee1394 devices KERNEL=="dv1394*", NAME="dv1394/%n" KERNEL=="video1394*", NAME="video1394/%n" # input devices KERNEL=="mice", NAME="input/%k" KERNEL=="mouse[0-9]*", NAME="input/%k" KERNEL=="event[0-9]*", NAME="input/%k" KERNEL=="js[0-9]*", NAME="input/%k" KERNEL=="ts[0-9]*", NAME="input/%k" KERNEL=="uinput", NAME="input/%k" # Zaptel KERNEL=="zapctl", NAME="zap/ctl" KERNEL=="zaptimer", NAME="zap/timer" KERNEL=="zapchannel", NAME="zap/channel" KERNEL=="zappseudo", NAME="zap/pseudo" KERNEL=="zap[0-9]*", NAME="zap/%n" # AOE character devices SUBSYSTEM=="aoe", KERNEL=="discover", NAME="etherd/%k" SUBSYSTEM=="aoe", KERNEL=="err", NAME="etherd/%k" SUBSYSTEM=="aoe", KERNEL=="interfaces", NAME="etherd/%k" # device mapper creates its own device nodes, so ignore these KERNEL=="dm-[0-9]*", OPTIONS+="ignore_device" KERNEL=="device-mapper", NAME="mapper/control" KERNEL=="rfcomm[0-9]*", NAME="%k", GROUP="users", MODE="0660" # Firmware Helper ACTION=="add", SUBSYSTEM=="firmware", RUN+="/lib/udev/firmware_helper" # Samsung UARTS KERNEL=="s3c2410_serial[0-9]", NAME="ttySAC%n" # MXC UARTs KERNEL=="ttymxc[0-4]", NAME="ttymxc%n" 070701002EC8C7000081A400000000000000000000000147CEEB6100000C23000000080000001100000000000000000000002300000000etc/udev/rules.d/permissions.rulesACTION!="add", GOTO="permissions_end" # workarounds needed to synchronize with sysfs DEVPATH=="/devices/*", ENV{PHYSDEVBUS}=="?*", WAIT_FOR_SYSFS="bus" SUBSYSTEM=="scsi", WAIT_FOR_SYSFS="ioerr_cnt" # only needed for kernels < 2.6.16 SUBSYSTEM=="net", WAIT_FOR_SYSFS="address" # only needed for kernels < 2.6.17 SUBSYSTEM=="net", ENV{PHYSDEVDRIVER}=="?*", WAIT_FOR_SYSFS="device/driver" # default permissions for block devices SUBSYSTEM=="block", GROUP="disk" SUBSYSTEM=="block", SYSFS{removable}=="1", GROUP="floppy" # IDE devices BUS=="ide", KERNEL=="hd[a-z]|pcd[0-9]*", DRIVER=="ide-cdrom|pcd", \ IMPORT{program}="cdrom_id --export $tempnode" ENV{ID_CDROM}=="?*", GROUP="cdrom" BUS=="ide", KERNEL=="ht[0-9]*", GROUP="tape" BUS=="ide", KERNEL=="nht[0-9]*", GROUP="tape" # SCSI devices BUS=="scsi", SYSFS{type}=="1", GROUP="tape" BUS=="scsi", SYSFS{type}=="5", GROUP="cdrom" # USB devices BUS=="usb", KERNEL=="legousbtower*", MODE="0666" BUS=="usb", KERNEL=="lp[0-9]*", GROUP="lp" # usbfs-like devices SUBSYSTEM=="usb_device", MODE="0664" # iRiver music players SUBSYSTEM=="usb_device", GROUP="plugdev", \ SYSFS{idVendor}=="4102", SYSFS{idProduct}=="10[01][135789]" # serial devices SUBSYSTEM=="tty", GROUP="dialout" SUBSYSTEM=="capi", GROUP="dialout" SUBSYSTEM=="slamr", GROUP="dialout" SUBSYSTEM=="zaptel", GROUP="dialout" # vc devices (all members of the tty subsystem) KERNEL=="ptmx", MODE="0666", GROUP="root" KERNEL=="console", MODE="0600", GROUP="root" KERNEL=="tty", MODE="0666", GROUP="root" KERNEL=="tty[0-9]*", GROUP="root" KERNEL=="pty*", MODE="0666", GROUP="tty" # video devices SUBSYSTEM=="video4linux", GROUP="video" SUBSYSTEM=="drm", GROUP="video" SUBSYSTEM=="dvb", GROUP="video" SUBSYSTEM=="em8300", GROUP="video" SUBSYSTEM=="graphics", GROUP="video" SUBSYSTEM=="nvidia", GROUP="video" # misc devices KERNEL=="random", MODE="0666" KERNEL=="urandom", MODE="0666" KERNEL=="mem", MODE="0640", GROUP="kmem" KERNEL=="kmem", MODE="0640", GROUP="kmem" KERNEL=="port", MODE="0640", GROUP="kmem" KERNEL=="full", MODE="0666" KERNEL=="null", MODE="0666" KERNEL=="zero", MODE="0666" KERNEL=="inotify", MODE="0666" KERNEL=="sgi_fetchop", MODE="0666" KERNEL=="sonypi", MODE="0666" KERNEL=="agpgart", GROUP="video" KERNEL=="rtc", GROUP="audio" KERNEL=="cdemu[0-9]*", GROUP="cdrom" KERNEL=="pktcdvd[0-9]*", GROUP="cdrom" KERNEL=="pktcdvd", MODE="0644" # printers and parallel devices SUBSYSTEM=="printer", GROUP="lp" SUBSYSTEM=="ppdev", GROUP="lp" KERNEL=="pt[0-9]*", GROUP="tape" KERNEL=="pht[0-9]*", GROUP="tape" # sound devices SUBSYSTEM=="sound", GROUP="audio" # ieee1394 devices KERNEL=="raw1394", GROUP="disk" KERNEL=="dv1394*", GROUP="video" KERNEL=="video1394*", GROUP="video" # input devices KERNEL=="event[0-9]*", SYSFS{name}=="*dvb*|*DVB*|* IR *" \ MODE="0664", GROUP="video" KERNEL=="js[0-9]*", MODE="0664" # AOE character devices SUBSYSTEM=="aoe", MODE="0220", GROUP="disk" SUBSYSTEM=="aoe", KERNEL=="err", MODE="0440" LABEL="permissions_end" 070701002EC8C8000081A400000000000000000000000147CEEB61000000E2000000080000001100000000000000000000001300000000etc/udev/udev.conf# udev.conf # The initial syslog(3) priority: "err", "info", "debug" or its # numerical equivalent. For runtime debugging, the daemons internal # state can be changed with: "udevcontrol log_priority=". udev_log="err" 070701002EC7C0000081A400000000000000000000000147CEEAEA000002C0000000080000001100000000000000000000000A00000000etc/fstab# stock fstab - you probably want to override this with a machine specific one rootfs / auto defaults 1 1 proc /proc proc defaults 0 0 devpts /dev/pts devpts mode=0620,gid=5 0 0 usbdevfs /proc/bus/usb usbdevfs noauto 0 0 tmpfs /var tmpfs defaults 0 0 tmpfs /media/ram tmpfs defaults 0 0 # uncomment this if your device has a SD/MMC/Transflash slot #/dev/mmcblk0p1 /media/card auto defaults,sync,noauto 0 0 070701002ECE2E000081B400000000000000000000000147CEFAFD0000000D000000080000001100000000000000000000000C00000000etc/version200803051955 070701002EC7C1000041ED00000000000000000000000247CEFADA00000000000000080000001100000000000000000000000900000000etc/skel070701002EC7C2000081ED00000000000000000000000147CEEAEA00000098000000080000001100000000000000000000001200000000etc/skel/.profile# ~/.profile: executed by Bourne-compatible login shells. if [ -f ~/.bashrc ]; then . ~/.bashrc fi # path set by /etc/profile # export PATH mesg n 070701002EC7C3000081ED00000000000000000000000147CEEAEA0000019A000000080000001100000000000000000000001100000000etc/skel/.bashrc# ~/.bashrc: executed by bash(1) for non-login shells. export PS1='\h:\w\$ ' umask 022 # You may uncomment the following lines if you want `ls' to be colorized: # export LS_OPTIONS='--color=auto' # eval `dircolors` # alias ls='ls $LS_OPTIONS' # alias ll='ls $LS_OPTIONS -l' # alias l='ls $LS_OPTIONS -lA' # # Some more alias to avoid making mistakes: # alias rm='rm -i' # alias cp='cp -i' # alias mv='mv -i' 070701002EC7C40000A1FF00000000000000000000000147CEFADA0000000C000000080000001100000000000000000000000900000000etc/mtab/proc/mounts070701002EC81D000081ED00000000000000000000000147CEEAEB00001A0A000000080000001100000000000000000000001100000000etc/device_table#/dev/ d 775 0 0 - - - - - #/dev/msys d 775 0 0 - - - - - #/dev/pts d 775 0 0 - - - - - #/var d 775 0 0 - - - - - /boot/var/empty d 755 0 3 - - - - /dev/apm_bios c 660 0 46 10 134 - - - /dev/audio c 660 0 29 14 4 - - - /dev/audio1 c 660 0 29 14 20 - - - /dev/audio2 c 660 0 29 14 36 - - - /dev/audio3 c 660 0 29 14 52 - - - /dev/bty c 644 0 0 60 0 0 1 5 /dev/sharp_fl c 640 0 44 254 0 - - - /dev/console c 660 0 5 5 1 - - /dev/cusa0 c 640 0 0 205 5 - - - /dev/cusa1 c 640 0 0 205 6 - - - /dev/cusa2 c 640 0 0 205 7 - - - /dev/dsp c 660 0 29 14 3 - - - /dev/dsp1 c 660 0 29 14 19 - - - /dev/dsp2 c 660 0 29 14 35 - - - /dev/dsp3 c 660 0 29 14 51 - - - /dev/fb c 660 0 44 29 0 0 32 2 /dev/fb0autodetect c 660 0 44 29 1 - - - /dev/fb0current c 660 0 44 29 0 - - - #/dev/fb1 c 660 0 44 29 32 - - - /dev/fb1autodetect c 660 0 44 29 33 - - - /dev/fb1current c 660 0 44 29 32 - - - /dev/full c 666 0 7 - - - /dev/hda b 660 0 6 3 0 - - - /dev/hda b 660 0 6 3 1 1 1 20 /dev/hdb b 660 0 6 3 64 - - - /dev/hdb b 660 0 6 3 65 1 1 20 /dev/hdc b 660 0 6 22 0 - - - /dev/hdc b 660 0 6 22 1 1 1 20 /dev/initctl p 600 0 0 - - - - /dev/i2c0 c 660 0 0 89 0 - - - /dev/inportbm c 660 0 0 10 2 - - - /dev/input/event c 660 0 0 13 64 0 1 20 /dev/ircomm0 c 640 0 0 161 0 - - - /dev/jbm c 660 0 0 10 4 - - - /dev/kmem c 640 0 15 1 2 - - - /dev/lirc c 660 0 5 61 0 - - - /dev/logibm c 660 0 0 10 0 - - - /dev/loop0 b 660 0 11 7 0 - - - /dev/loop1 b 660 0 11 7 1 - - - /dev/mem c 640 0 15 1 1 - - - /dev/mixer c 666 0 0 14 0 - - - /dev/mixer1 c 666 0 0 14 16 - - - /dev/mixer2 c 666 0 0 14 32 - - - /dev/mixer3 c 666 0 0 14 48 - - - /dev/mmcda b 640 0 0 60 0 - - - /dev/mmcda1 b 640 0 0 60 1 - - - /dev/mmcda2 b 640 0 0 60 2 - - - /dev/msys/fla b 660 0 11 100 0 - - - /dev/msys/fla1 b 660 0 11 100 1 - - - /dev/msys/fla2 b 660 0 11 100 2 - - - /dev/msys/fla3 b 660 0 11 100 3 - - - /dev/msys/fla4 b 660 0 11 100 4 - - - /dev/msys/flb b 660 0 11 100 64 - - - /dev/msys/flb1 b 660 0 11 100 65 - - - /dev/msys/flb2 b 660 0 11 100 66 - - - /dev/msys/flb3 b 660 0 11 100 67 - - - /dev/msys/flb4 b 660 0 11 100 68 - - - /dev/mtd c 660 0 6 90 0 0 2 8 /dev/mtdblock b 640 0 0 31 0 0 1 8 /dev/nst0 c 664 0 11 9 128 - - - /dev/nst0a c 664 0 11 9 224 - - - /dev/nst0l c 664 0 11 9 160 - - - /dev/nst0m c 664 0 11 9 192 - - - /dev/nst1 c 664 0 11 9 129 - - - /dev/nst1a c 664 0 11 9 225 - - - /dev/nst1l c 664 0 11 9 161 - - - /dev/nst1m c 664 0 11 9 193 - - - /dev/null c 666 0 0 1 3 - - - /dev/par0 c 660 0 7 6 0 - - - /dev/par1 c 660 0 7 6 1 - - - /dev/par2 c 660 0 7 6 2 - - - /dev/port c 640 0 15 1 4 - - - /dev/ppp c 640 0 0 108 0 - - - /dev/psaux c 660 0 0 10 1 - - - /dev/ptmx c 666 0 5 5 2 - - - /dev/ptya0 c 660 0 5 2 176 - - - /dev/ptya1 c 660 0 5 2 177 - - - /dev/ptya2 c 660 0 5 2 178 - - - /dev/ptya3 c 660 0 5 2 179 - - - /dev/ptya4 c 660 0 5 2 180 - - - /dev/ptya5 c 660 0 5 2 181 - - - /dev/ptya6 c 660 0 5 2 182 - - - /dev/ptya7 c 660 0 5 2 183 - - - /dev/ptya8 c 660 0 5 2 184 - - - /dev/ptya9 c 660 0 5 2 185 - - - /dev/ptyaa c 660 0 5 2 186 - - - /dev/ptyab c 660 0 5 2 187 - - - /dev/ptyac c 660 0 5 2 188 - - - /dev/ptyad c 660 0 5 2 189 - - - /dev/ptyae c 660 0 5 2 190 - - - /dev/ptyaf c 660 0 5 2 191 - - - /dev/ram b 640 0 0 1 0 0 1 4 /dev/random c 444 0 0 1 8 - - - /dev/rfcomm0 c 660 0 0 216 0 - - - /dev/rfcomm1 c 660 0 0 216 1 - - - /dev/rfcomm2 c 660 0 0 216 2 - - - /dev/rfcomm3 c 660 0 0 216 3 - - - /dev/rfcomm4 c 660 0 0 216 4 - - - /dev/rfcomm5 c 660 0 0 216 5 - - - /dev/rfcomm6 c 660 0 0 216 6 - - - /dev/rfcomm7 c 660 0 0 216 7 - - - /dev/rfcomm8 c 660 0 0 216 8 - - - /dev/rfcomm9 c 660 0 0 216 9 - - - /dev/rfcomm10 c 660 0 0 216 10 - - - /dev/rfcomm11 c 660 0 0 216 11 - - - /dev/rfcomm12 c 660 0 0 216 12 - - - /dev/rfcomm13 c 660 0 0 216 13 - - - /dev/rfcomm14 c 660 0 0 216 14 - - - /dev/rfcomm15 c 660 0 0 216 15 - - - /dev/rmidi0 c 660 0 0 35 64 - - - /dev/rmidi1 c 660 0 0 35 65 - - - /dev/rmidi2 c 660 0 0 35 66 - - - /dev/rmidi3 c 660 0 0 35 67 - - - /dev/rtc c 660 0 47 10 135 - - - /dev/scd0 b 660 0 6 11 0 - - - /dev/scd1 b 660 0 6 11 1 - - - /dev/sda b 660 0 6 8 0 - - - /dev/sda1 b 660 0 6 8 1 - - - /dev/sda2 b 660 0 6 8 2 - - - /dev/sda3 b 660 0 6 8 3 - - - /dev/sda4 b 660 0 6 8 4 - - - /dev/sda5 b 660 0 6 8 5 - - - /dev/sda6 b 660 0 6 8 6 - - - /dev/sda7 b 660 0 6 8 7 - - - /dev/sda8 b 660 0 6 8 8 - - - /dev/sda9 b 660 0 6 8 9 - - - /dev/sdb b 660 0 6 8 16 - - - /dev/sdb1 b 660 0 6 8 17 - - - /dev/sdb2 b 660 0 6 8 18 - - - /dev/sdb3 b 660 0 6 8 19 - - - /dev/sdb4 b 660 0 6 8 20 - - - /dev/sdb5 b 660 0 6 8 21 - - - /dev/sdb6 b 660 0 6 8 22 - - - /dev/sdb7 b 660 0 6 8 23 - - - /dev/sdb8 b 660 0 6 8 24 - - - /dev/sdb9 b 660 0 6 8 25 - - - /dev/sdc b 660 0 6 8 32 - - - /dev/sdc1 b 660 0 6 8 33 - - - /dev/sdc2 b 660 0 6 8 34 - - - /dev/sdc3 b 660 0 6 8 35 - - - /dev/sdc4 b 660 0 6 8 36 - - - /dev/sdc5 b 660 0 6 8 37 - - - /dev/sdc6 b 660 0 6 8 38 - - - /dev/sdc7 b 660 0 6 8 39 - - - /dev/sdc8 b 660 0 6 8 40 - - - /dev/sdc9 b 660 0 6 8 41 - - - /dev/sd_slotstat c 660 0 6 10 240 - - - /dev/sharp_audioctl c 660 0 29 10 213 - - - /dev/sharp_buz c 660 0 29 10 211 - - - /dev/sharp_kbdctl c 660 0 45 10 214 - - - /dev/sharp_led c 660 0 48 10 210 - - - /dev/sharp_ts c 640 0 45 11 0 - - - /dev/smtpe0 c 640 0 0 35 128 - - - /dev/smtpe1 c 640 0 0 35 129 - - - /dev/smtpe2 c 640 0 0 35 130 - - - /dev/smtpe3 c 640 0 0 35 131 - - - /dev/sndstat c 660 0 29 14 6 - - - /dev/snd/seq c 660 0 0 116 1 - - - /dev/snd/timer c 660 0 0 116 33 - - - /dev/snd/controlC0 c 660 0 0 116 0 - - - /dev/snd/controlC1 c 660 0 0 116 32 - - - /dev/snd/controlC2 c 660 0 0 116 64 - - - /dev/snd/controlC3 c 660 0 0 116 96 - - - /dev/snd/hwC0D0 c 660 0 0 116 4 - - - /dev/snd/hwC0D1 c 660 0 0 116 5 - - - /dev/snd/hwC0D2 c 660 0 0 116 6 - - - /dev/snd/hwC0D3 c 660 0 0 116 7 - - - /dev/snd/pcmC0D0c c 660 0 0 116 24 - - - /dev/snd/pcmC0D0p c 660 0 0 116 16 - - - /dev/snd/pcmC0D1c c 660 0 0 116 25 - - - /dev/snd/pcmC0D1p c 660 0 0 116 17 - - - /dev/snd/pcmC0D2c c 660 0 0 116 26 - - - /dev/snd/pcmC0D2p c 660 0 0 116 18 - - - /dev/snd/pcmC0D3c c 660 0 0 116 27 - - - /dev/snd/pcmC0D3p c 660 0 0 116 19 - - - /dev/st0 c 660 0 11 9 0 - - - /dev/st0a c 660 0 11 9 96 - - - /dev/st0l c 660 0 11 9 32 - - - /dev/st0m c 660 0 11 9 64 - - - /dev/st1 c 660 0 11 9 1 - - - /dev/st1a c 660 0 11 9 97 - - - /dev/st1l c 660 0 11 9 33 - - - /dev/st1m c 660 0 11 9 65 - - - /dev/tty c 664 0 5 5 0 - - - /dev/tty c 666 0 5 4 0 0 1 9 /dev/ttyS c 640 0 5 4 64 0 1 4 /dev/ttySA c 640 0 5 204 5 0 1 4 /dev/ttyUSB c 660 0 5 188 0 0 1 2 /dev/urandom c 644 0 0 1 9 - - - /dev/usbmouse c 640 0 45 10 32 - - - /dev/zero c 644 0 0 1 5 - - - /dev/input/mice c 660 0 0 13 63 - - - 070701002EC7C5000081A400000000000000000000000147CEEAEA00000661000000080000001100000000000000000000000C00000000etc/inputrc# /etc/inputrc - global inputrc for libreadline # See readline(3readline) and `info rluserman' for more information. # Be 8 bit clean. set input-meta on set output-meta on # To allow the use of 8bit-characters like the german umlauts, comment out # the line below. However this makes the meta key not work as a meta key, # which is annoying to those which don't need to type in 8-bit characters. # set convert-meta off # try to enable the application keypad when it is called. Some systems # need this to enable the arrow keys. # set enable-keypad on # see /usr/share/doc/bash/inputrc.arrows for other codes of arrow keys # do not bell on tab-completion # set bell-style none # some defaults / modifications for the emacs mode $if mode=emacs # allow the use of the Home/End keys # "\e[1~": beginning-of-line # "\e[4~": end-of-line # allow the use of the Delete/Insert keys # "\e[3~": delete-char # "\e[2~": quoted-insert # mappings for "page up" and "page down" to step to the beginning/end # of the history # "\e[5~": beginning-of-history # "\e[6~": end-of-history # alternate mappings for "page up" and "page down" to search the history # "\e[5~": history-search-backward # "\e[6~": history-search-forward # # mappings for Ctrl-left-arrow and Ctrl-right-arrow for word moving # "\e[5C": forward-word # "\e[5D": backward-word # "\e\e[C": forward-word # "\e\e[D": backward-word # $if term=rxvt # "\e[8~": end-of-line # $endif # for non RH/Debian xterm, can't hurt for RH/DEbian xterm # "\eOH": beginning-of-line # "\eOF": end-of-line # for freebsd console # "\e[H": beginning-of-line # "\e[F": end-of-line $endif 070701002EC7C6000081A400000000000000000000000147CEEAEA0000001A000000080000001100000000000000000000000E00000000etc/host.conforder hosts,bind multi on 070701002EC81E000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000A00000000etc/rcS.d070701002EC81F0000A1FF00000000000000000000000147CEFADB00000010000000080000001100000000000000000000001400000000etc/rcS.d/S99finish../init.d/finish070701002EC8200000A1FF00000000000000000000000147CEFADB00000015000000080000001100000000000000000000001900000000etc/rcS.d/S35mountall.sh../init.d/mountall.sh070701002ECE270000A1FF00000000000000000000000147CEFAFD0000000E000000080000001100000000000000000000001200000000etc/rcS.d/S03udev../init.d/udev070701002EC8210000A1FF00000000000000000000000147CEFADB00000010000000080000001100000000000000000000001400000000etc/rcS.d/S02banner../init.d/banner070701002ECDF90000A1FF00000000000000000000000147CEFAFD00000014000000080000001100000000000000000000001800000000etc/rcS.d/S40networking../init.d/networking070701002EC8220000A1FF00000000000000000000000147CEFADB00000013000000080000001100000000000000000000001700000000etc/rcS.d/S38devpts.sh../init.d/devpts.sh070701002EC8230000A1FF00000000000000000000000147CEFADB00000015000000080000001100000000000000000000001900000000etc/rcS.d/S45mountnfs.sh../init.d/mountnfs.sh070701002EC8240000A1FF00000000000000000000000147CEFADB0000001E000000080000001100000000000000000000002200000000etc/rcS.d/S37populate-volatile.sh../init.d/populate-volatile.sh070701002EC8250000A1FF00000000000000000000000147CEFADB00000015000000080000001100000000000000000000001900000000etc/rcS.d/S55bootmisc.sh../init.d/bootmisc.sh070701002ECE090000A1FF00000000000000000000000147CEFAFD00000015000000080000001100000000000000000000001900000000etc/rcS.d/S20modutils.sh../init.d/modutils.sh070701002EC8260000A1FF00000000000000000000000147CEFADB00000016000000080000001100000000000000000000001700000000etc/rcS.d/S06alignment../init.d/alignment.sh070701002EC8270000A1FF00000000000000000000000147CEFADB00000011000000080000001100000000000000000000001500000000etc/rcS.d/S05devices../init.d/devices070701002EC8280000A1FF00000000000000000000000147CEFADB00000015000000080000001100000000000000000000001900000000etc/rcS.d/S39hostname.sh../init.d/hostname.sh070701002EC8290000A1FF00000000000000000000000147CEFADB00000016000000080000001100000000000000000000001A00000000etc/rcS.d/S10checkroot.sh../init.d/checkroot.sh070701002EC82A0000A1FF00000000000000000000000147CEFADB00000011000000080000001100000000000000000000001500000000etc/rcS.d/S30ramdisk../init.d/ramdisk070701002EC82B0000A1FF00000000000000000000000147CEFADB00000012000000080000001100000000000000000000001300000000etc/rcS.d/S03sysfs../init.d/sysfs.sh070701002EC7C7000081A400000000000000000000000147CEEAEA0000035B000000080000001100000000000000000000000C00000000etc/profile# /etc/profile: system-wide .profile file for the Bourne shell (sh(1)) # and Bourne compatible shells (bash(1), ksh(1), ash(1), ...). PATH="/usr/local/bin:/usr/bin:/bin" EDITOR="/bin/vi" # needed for packages like cron test -z "$TERM" && TERM="vt100" # Basic terminal capab. For screen etc. if [ ! -e /etc/localtime ]; then TZ="UTC" # Time Zone. Look at http://theory.uwinnipeg.ca/gnu/glibc/libc_303.html # for an explanation of how to set this to your local timezone. export TZ fi if [ "`id -u`" -eq 0 ]; then PATH=$PATH:/usr/local/sbin:/usr/sbin:/sbin: fi if [ "$PS1" ]; then # works for bash and ash (no other shells known to be in use here) PS1='\u@\h:\w\$ ' fi if [ -d /etc/profile.d ]; then for i in `ls /etc/profile.d/`; do . /etc/profile.d/$i done unset i fi export PATH PS1 OPIEDIR QPEDIR QTDIR EDITOR TERM umask 022 070701002EC82C000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000A00000000etc/rc1.d070701002ECE0F0000A1FF00000000000000000000000147CEFAFD00000014000000080000001100000000000000000000001800000000etc/rc1.d/K40networking../init.d/networking070701002ECE070000A1FF00000000000000000000000147CEFAFD00000010000000080000001100000000000000000000001400000000etc/rc1.d/K20syslog../init.d/syslog070701002EC82D000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000A00000000etc/rc0.d070701002ECE0C0000A1FF00000000000000000000000147CEFAFD00000014000000080000001100000000000000000000001800000000etc/rc0.d/K40networking../init.d/networking070701002EC82E0000A1FF00000000000000000000000147CEFADB00000015000000080000001100000000000000000000001900000000etc/rc0.d/S25save-rtc.sh../init.d/save-rtc.sh070701002EC82F0000A1FF00000000000000000000000147CEFADB00000012000000080000001100000000000000000000001600000000etc/rc0.d/S20sendsigs../init.d/sendsigs070701002ECE030000A1FF00000000000000000000000147CEFAFD00000010000000080000001100000000000000000000001400000000etc/rc0.d/K20syslog../init.d/syslog070701002EC8300000A1FF00000000000000000000000147CEFADB00000012000000080000001100000000000000000000001600000000etc/rc0.d/S40umountfs../init.d/umountfs070701002EC8310000A1FF00000000000000000000000147CEFADB00000016000000080000001100000000000000000000001A00000000etc/rc0.d/S31umountnfs.sh../init.d/umountnfs.sh070701002EC8320000A1FF00000000000000000000000147CEFADB0000000E000000080000001100000000000000000000001200000000etc/rc0.d/S90halt../init.d/halt070701002EC833000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000A00000000etc/rc3.d070701002EC8340000A1FF00000000000000000000000147CEFADB00000013000000080000001100000000000000000000001700000000etc/rc3.d/S99rmnologin../init.d/rmnologin070701002ECDFE0000A1FF00000000000000000000000147CEFAFD00000010000000080000001100000000000000000000001400000000etc/rc3.d/S20syslog../init.d/syslog070701002EC835000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000A00000000etc/rc4.d070701002EC8360000A1FF00000000000000000000000147CEFADB00000013000000080000001100000000000000000000001700000000etc/rc4.d/S99rmnologin../init.d/rmnologin070701002ECDDB0000A1FF00000000000000000000000147CEFAFD00000010000000080000001100000000000000000000001400000000etc/rc4.d/S20syslog../init.d/syslog070701002EC800000041ED00000000000000000000000247CEFADA00000000000000080000001100000000000000000000000D00000000etc/udhcpc.d070701002EC801000081ED00000000000000000000000147CEEB0400000333000000080000001100000000000000000000001700000000etc/udhcpc.d/50default#!/bin/sh # udhcpc script edited by Tim Riker [ -z "$1" ] && echo "Error: should be called from udhcpc" && exit 1 RESOLV_CONF="/etc/resolv.conf" [ -n "$broadcast" ] && BROADCAST="broadcast $broadcast" [ -n "$subnet" ] && NETMASK="netmask $subnet" case "$1" in deconfig) /sbin/ifconfig $interface 0.0.0.0 ;; renew|bound) /sbin/ifconfig $interface $ip $BROADCAST $NETMASK if [ -n "$router" ] ; then while route del default gw 0.0.0.0 dev $interface 2>/dev/null ; do : done metric=0 for i in $router ; do route add default gw $i dev $interface metric $((metric++)) done fi echo -n > $RESOLV_CONF [ -n "$domain" ] && echo search $domain >> $RESOLV_CONF for i in $dns ; do echo adding dns $i echo nameserver $i >> $RESOLV_CONF done ;; esac exit 0 070701002EC868000041ED00000000000000000000000647CEFADB00000000000000080000001100000000000000000000000C00000000etc/network070701002EC869000041ED00000000000000000000000247CEEAED00000000000000080000001100000000000000000000001B00000000etc/network/if-post-down.d070701002EC86A000041ED00000000000000000000000247CEEAED00000000000000080000001100000000000000000000001600000000etc/network/if-down.d070701002EC86B000081A400000000000000000000000147CEEAEA00000261000000080000001100000000000000000000001700000000etc/network/interfaces# /etc/network/interfaces -- configuration file for ifup(8), ifdown(8) # The loopback interface auto lo iface lo inet loopback # Wireless interfaces iface wlan0 inet dhcp wireless_mode managed wireless_essid any wpa-driver wext wpa-conf /etc/wpa_supplicant.conf iface atml0 inet dhcp # Wired or wireless interfaces iface eth0 inet dhcp iface eth1 inet dhcp # Ethernet/RNDIS gadget (g_ether) # ... or on host side, usbnet and random hwaddr iface usb0 inet static address 192.168.0.202 netmask 255.255.255.0 network 192.168.0.0 gateway 192.168.0.200 # Bluetooth networking iface bnep0 inet dhcp 070701002EC86C000041ED00000000000000000000000247CEEAED00000000000000080000001100000000000000000000001400000000etc/network/if-up.d070701002EC86D000081A400000000000000000000000147CEEAEA0000002D000000080000001100000000000000000000001400000000etc/network/optionsip_forward=no spoofprotect=yes syncookies=no 070701002EC86E000041ED00000000000000000000000247CEEAED00000000000000080000001100000000000000000000001800000000etc/network/if-pre-up.d070701002ECE2F000081B400000000000000000000000147CEFAFD0000000D000000080000001100000000000000000000000E00000000etc/timestamp030519562008 070701002EC8EF000041FD00000000000000000000000247CEFADB00000000000000080000001100000000000000000000000900000000etc/ipkg070701002EC8F0000081B400000000000000000000000147CEFADB0000007D000000080000001100000000000000000000001300000000etc/ipkg/arch.confarch all 1 arch any 6 arch noarch 11 arch arm 16 arch armv4 21 arch armv4t 26 arch armv5te 31 arch iwmmxt 36 arch cm-x270 41 070701002EC86F000081A400000000000000000000000147CEEAEA00000377000000080000001100000000000000000000000800000000etc/rpc# This file contains user readable names that can be used in place of rpc # program numbers. portmapper 100000 portmap sunrpc rstatd 100001 rstat rstat_svc rup perfmeter rusersd 100002 rusers nfs 100003 nfsprog ypserv 100004 ypprog mountd 100005 mount showmount ypbind 100007 walld 100008 rwall shutdown yppasswdd 100009 yppasswd etherstatd 100010 etherstat rquotad 100011 rquotaprog quota rquota sprayd 100012 spray 3270_mapper 100013 rje_mapper 100014 selection_svc 100015 selnsvc database_svc 100016 rexd 100017 rex alis 100018 sched 100019 llockmgr 100020 nlockmgr 100021 x25.inr 100022 statmon 100023 status 100024 bootparam 100026 ypupdated 100028 ypupdate keyserv 100029 keyserver tfsd 100037 nsed 100038 nsemntd 100039 ypxfrd 100069 pcnfsd 150001 amd 300019 amq sgi_fam 391002 ugidd 545580417 fypxfrd 600100069 freebsd-ypxfrd bwnfsd 788585389 070701002EC870000081A400000000000000000000000147CEEAEA0000002C000000080000001100000000000000000000000A00000000etc/hosts127.0.0.1 localhost.localdomain localhost 070701002EC8D2000041ED00000000000000000000000247CEEAEF00000000000000080000001100000000000000000000001100000000etc/alternatives070701002EC87B000081A400000000000000000000000147CEEAEF00000430000000080000001100000000000000000000000C00000000etc/inittab# /etc/inittab: init(8) configuration. # $Id: inittab,v 1.91 2002/01/25 13:35:21 miquels Exp $ # The default runlevel. id:5:initdefault: # Boot-time system configuration/initialization script. # This is run first except when booting in emergency (-b) mode. si::sysinit:/etc/init.d/rcS # What to do in single-user mode. ~~:S:wait:/sbin/sulogin # /etc/init.d executes the S and K scripts upon change # of runlevel. # # Runlevel 0 is halt. # Runlevel 1 is single-user. # Runlevels 2-5 are multi-user. # Runlevel 6 is reboot. l0:0:wait:/etc/init.d/rc 0 l1:1:wait:/etc/init.d/rc 1 l2:2:wait:/etc/init.d/rc 2 l3:3:wait:/etc/init.d/rc 3 l4:4:wait:/etc/init.d/rc 4 l5:5:wait:/etc/init.d/rc 5 l6:6:wait:/etc/init.d/rc 6 # Normally not reached, but fallthrough in case of emergency. z6:6:respawn:/sbin/sulogin S:2345:respawn:/sbin/getty 38400 ttyS0 # /sbin/getty invocations for the runlevels. # # The "id" field MUST be the same as the last # characters of the device (after "tty"). # # Format: # ::: # 1:2345:respawn:/sbin/getty 38400 tty1 070701002EC7C8000081A400000000000000000000000147CEEAEA00000023000000080000001100000000000000000000000A00000000etc/issueOpenedHand Linux (Poky) 3.1 \n \l 070701002EC802000041ED00000000000000000000000247CEFADB00000000000000080000001100000000000000000000000B00000000etc/init.d070701002EC837000081ED00000000000000000000000147CEEAEA000000C5000000080000001100000000000000000000001200000000etc/init.d/reboot#! /bin/sh # # reboot Execute the reboot command. # # Version: @(#)reboot 2.75 22-Jun-1998 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin echo -n "Rebooting... " reboot -d -f -i 070701002EC838000081ED00000000000000000000000147CEEAEA0000021F000000080000001100000000000000000000001500000000etc/init.d/devpts.sh#! /bin/sh . /etc/default/devpts test "`uname -s`" = "Linux" || exit 0 # # First find out if devpts is available. Also check if devfs # is already mounted - in that case we don't want to use devpts. # if test ! -e /dev/.devfsd && ( grep -q devpts /proc/filesystems ) then # # Create multiplexor device. # test -c /dev/ptmx || mknod -m 666 /dev/ptmx c 5 2 # # Mount /dev/pts if needed. # if ( ! grep -q devpts /proc/mounts ) then mkdir -p /dev/pts mount -t devpts devpts /dev/pts -ogid=${TTYGRP},mode=${TTYMODE} fi fi exit 0 070701002EC839000081ED00000000000000000000000147CEEAEA000000B8000000080000001100000000000000000000001400000000etc/init.d/sysfs.sh#!/bin/sh if [ -e /proc ] && ! [ -e /proc/mounts ]; then mount -t proc proc /proc fi if [ -e /sys ] && grep -q sysfs /proc/filesystems; then mount sysfs /sys -t sysfs fi exit 0 070701002EC83A000081ED00000000000000000000000147CEEAEA000001DE000000080000001100000000000000000000001500000000etc/init.d/functions# -*-Shell-script-*- # # functions This file contains functions to be used by most or all # shell scripts in the /etc/init.d directory. # cpuinfo_id() { # return the Hardware module ID awk 'BEGIN { FS=": " } /Hardware/ { print $2 } ' # Bruce Perens # # Version: @(#)rc 2.78 07-Nov-1999 miquels@cistron.nl # . /etc/default/rcS export VERBOSE startup_progress() { step=$(($step + $step_change)) if [ "$num_steps" != "0" ]; then progress=$((($step * $progress_size / $num_steps) + $first_step)) else progress=$progress_size fi #echo "PROGRESS is $progress $runlevel $first_step + ($step of $num_steps) $step_change $progress_size" if type psplash-write >/dev/null 2>&1; then TMPDIR=/mnt/.psplash psplash-write "PROGRESS $progress" || true fi } # # Start script or program. # startup() { # Handle verbosity [ "$VERBOSE" = very ] && echo "INIT: Running $@..." case "$1" in *.sh) # Source shell script for speed. ( trap - INT QUIT TSTP scriptname=$1 shift . $scriptname ) ;; *) "$@" ;; esac startup_progress } # Ignore CTRL-C only in this shell, so we can interrupt subprocesses. trap ":" INT QUIT TSTP # Set onlcr to avoid staircase effect. stty onlcr 0>&1 # Now find out what the current and what the previous runlevel are. runlevel=$RUNLEVEL # Get first argument. Set new runlevel to this argument. [ "$1" != "" ] && runlevel=$1 if [ "$runlevel" = "" ] then echo "Usage: $0 " >&2 exit 1 fi previous=$PREVLEVEL [ "$previous" = "" ] && previous=N export runlevel previous # Is there an rc directory for this new runlevel? if [ -d /etc/rc$runlevel.d ] then # Find out where in the progress bar the initramfs got to. PROGRESS_STATE=0 #if [ -f /dev/.initramfs/progress_state ]; then # . /dev/.initramfs/progress_state #fi # Split the remaining portion of the progress bar into thirds progress_size=$(((100 - $PROGRESS_STATE) / 3)) case "$runlevel" in 0|6) # Count down from -100 to 0 and use the entire bar first_step=-100 progress_size=100 step_change=1 ;; S) # Begin where the initramfs left off and use 2/3 # of the remaining space first_step=$PROGRESS_STATE progress_size=$(($progress_size * 2)) step_change=1 ;; *) # Begin where rcS left off and use the final 1/3 of # the space (by leaving progress_size unchanged) first_step=$(($progress_size * 2 + $PROGRESS_STATE)) step_change=1 ;; esac num_steps=0 for s in /etc/rc$runlevel.d/[SK]*; do case "${s##/etc/rc$runlevel.d/S??}" in gdm|xdm|kdm|reboot|halt) break ;; esac num_steps=$(($num_steps + 1)) done step=0 # First, run the KILL scripts. if [ $previous != N ] then for i in /etc/rc$runlevel.d/K[0-9][0-9]* do # Check if the script is there. [ ! -f $i ] && continue # Stop the service. startup $i stop done fi # Now run the START scripts for this runlevel. for i in /etc/rc$runlevel.d/S* do [ ! -f $i ] && continue if [ $previous != N ] && [ $previous != S ] then # # Find start script in previous runlevel and # stop script in this runlevel. # suffix=${i#/etc/rc$runlevel.d/S[0-9][0-9]} stop=/etc/rc$runlevel.d/K[0-9][0-9]$suffix previous_start=/etc/rc$previous.d/S[0-9][0-9]$suffix # # If there is a start script in the previous level # and _no_ stop script in this level, we don't # have to re-start the service. # [ -f $previous_start ] && [ ! -f $stop ] && continue fi case "$runlevel" in 0|6) startup $i stop ;; *) startup $i start ;; esac done fi #Uncomment to cause psplash to exit manually, otherwise it exits when it sees a VC switch #if [ "x$runlevel" != "xS" ]; then # if type psplash-write >/dev/null 2>&1; then # TMPDIR=/mnt/.psplash psplash-write "QUIT" || true # umount /mnt/.psplash # fi #fi 070701002EC83B000081ED00000000000000000000000147CEEAEA00000047000000080000001100000000000000000000001200000000etc/init.d/finish#!/bin/sh if ! test -e /etc/.configured; then > /etc/.configured fi 070701002EC83C000081ED00000000000000000000000147CEEAEA00000659000000080000001100000000000000000000001300000000etc/init.d/ramdisk#!/bin/sh . /etc/default/rcS FSTYPE=ext2 if test ! -e /proc/mtd then test "$VERBOSE" != "no" && echo >&2 "/proc not mounted, or mtd support not enabled in kernel." exit fi RAM_MTD_NO=`cat /proc/mtd | grep mtdram | tail -n 1 | cut -d: -f1 | cut -dd -f2` if test -z "$RAM_MTD_NO"; then exit 0; fi if test -e /dev/mtdblock/0 then RAM_MTD=/dev/mtd/$RAM_MTD_NO RAM_MTDBLK=/dev/mtdblock/$RAM_MTD_NO else RAM_MTD=/dev/mtd$RAM_MTD_NO RAM_MTDBLK=/dev/mtdblock$RAM_MTD_NO fi if grep -q $RAM_MTDBLK /etc/mtab; then echo "Device $RAM_MTDBLK already mounted"; exit 0; fi if test ! -e $RAM_MTD; then echo >&2 "Mtdram device $RAM_MTD does not exist!"; exit 1; fi RAM_MNTPT=/mnt/ram RAM_MTD_SIZE_HEX=`cat /proc/mtd | grep mtdram | tail -n 1 | cut -d" " -f 2` RAM_MTD_SIZE=`dc 0x$RAM_MTD_SIZE_HEX 1024 / p` test -e /etc/ramdisk.conf && OLD_MTD_SIZE=`cat /etc/ramdisk.conf` echo $RAM_MTD_SIZE > /etc/ramdisk.conf if test ! -d "$RAM_MNTPT"; then echo >&2 "Mountpoint $RAM_MNTPT does not exist!"; exit 0; fi if (test ! -e /etc/.configured) || test "$OLD_MTD_SIZE" != "$RAM_MTD_SIZE"; then test "$VERBOSE" != "no" && echo -n "Wiping ramdisk: " dd if=/dev/zero bs=1024 count=$RAM_MTD_SIZE of=$RAM_MTD 2>/dev/null >&2 || exit 1 test "$VERBOSE" != "no" && echo "$RAM_MTD"; test "$VERBOSE" != "no" && echo -n "Creating filesystem on ramdisk: " mkfs.$FSTYPE $RAM_MTDBLK 2>/dev/null >&2 || exit 1 test "$VERBOSE" != "no" && echo "$RAM_MTDBLK"; fi test "$VERBOSE" != "no" && echo -n "Mounting ramdisk: " mount -t $FSTYPE $RAM_MTDBLK $RAM_MNTPT 2>/dev/null >&2 || exit 1 test "$VERBOSE" != "no" && echo "$RAM_MTDBLK"; exit 0 070701002EC83D000081ED00000000000000000000000147CEEAEA000001D2000000080000001100000000000000000000001200000000etc/init.d/single#! /bin/sh # # single executed by init(8) upon entering runlevel 1 (single). # # Version: @(#)single 1.20 26-Geb-2001 miquels@cistron.nl # PATH="/sbin:/bin:/usr/sbin:/usr/bin" # Kill all processes. echo "Sending all processes the TERM signal..." killall5 -15 sleep 5 echo "Sending all processes the KILL signal..." killall5 -9 # We start update here, since we just killed it. test -x /sbin/update && update echo "Entering single-user mode..." exec init -t1 S 070701002EC85D000081ED00000000000000000000000147CEEAEB00000268000000080000001100000000000000000000001700000000etc/init.d/modutils.sh#!/bin/sh LOAD_MODULE=modprobe [ -f /proc/modules ] || exit 0 [ -f /etc/modules ] || exit 0 [ -e /sbin/modprobe ] || LOAD_MODULE=insmod if [ ! -e /sbin/depmod ]; then [ -f /lib/modules/`uname -r`/modules.dep ] || LOAD_MODULE=insmod else [ "$VERBOSE" != no ] && echo "Calculating module dependencies ..." depmod -Ae fi [ "$VERBOSE" != no ] && echo -n "Loading modules: " (cat /etc/modules; echo; ) | while read module args do case "$module" in \#*|"") continue ;; esac [ "$VERBOSE" != no ] && echo -n "$module " eval "$LOAD_MODULE $module $args >/dev/null 2>&1" done [ "$VERBOSE" != no ] && echo exit 0 070701002EC804000081ED00000000000000000000000147CEEB04000008B2000000080000001100000000000000000000001600000000etc/init.d/hwclock.sh#!/bin/sh # hwclock.sh Set system clock to hardware clock, according to the UTC # setting in /etc/default/rcS (see also rcS(5)). # # WARNING: If your hardware clock is not in UTC/GMT, this script # must know the local time zone. This information is # stored in /etc/localtime. This might be a problem if # your /etc/localtime is a symlink to something in # /usr/share/zoneinfo AND /usr isn't in the root # partition! The workaround is to define TZ either # in /etc/default/rcS, or in the proper place below. [ ! -x /sbin/hwclock ] && exit 0 . /etc/default/rcS case "$1" in start) if [ "$VERBOSE" != no ] then echo "System time was `date`." echo "Setting the System Clock using the Hardware Clock as reference..." fi if [ "$HWCLOCKACCESS" != no ] then if [ -z "$TZ" ] then hwclock --hctosys else TZ="$TZ" hwclock --hctosys fi fi if [ "$VERBOSE" != no ] then echo "System Clock set. System local time is now `date`." fi ;; stop|restart|reload|force-reload) # # Updates the Hardware Clock with the System Clock time. # This will *override* any changes made to the Hardware Clock. # # WARNING: If you disable this, any changes to the system # clock will not be carried across reboots. # if [ "$VERBOSE" != no ] then echo "Saving the System Clock time to the Hardware Clock..." fi if [ "$HWCLOCKACCESS" != no ] then hwclock --systohc fi if [ "$VERBOSE" != no ] then echo "Hardware Clock updated to `date`." fi exit 0 ;; show) if [ "$HWCLOCKACCESS" != no ] then hwclock --show fi ;; *) echo "Usage: hwclock.sh {start|stop|show|reload|restart}" >&2 echo " start sets kernel (system) clock from hardware (RTC) clock" >&2 echo " stop and reload set hardware (RTC) clock from kernel (system) clock" >&2 exit 1 ;; esac 070701002EC83E000081ED00000000000000000000000147CEEAEA00000436000000080000001100000000000000000000001300000000etc/init.d/urandom#! /bin/sh # # urandom This script saves the random seed between reboots. # It is called from the boot, halt and reboot scripts. # # Version: @(#)urandom 1.33 22-Jun-1998 miquels@cistron.nl # test -c /dev/urandom || exit 0 . /etc/default/rcS case "$1" in start|"") test "$VERBOSE" != no && echo "Initializing random number generator..." # Load and then save 512 bytes, # which is the size of the entropy pool if test -f /var/lib/urandom/random-seed then cat /var/lib/urandom/random-seed >/dev/urandom fi rm -f /var/lib/urandom/random-seed umask 077 dd if=/dev/urandom of=/var/lib/urandom/random-seed count=1 \ >/dev/null 2>&1 || echo "urandom start: failed." umask 022 ;; stop) # Carry a random seed from shut-down to start-up; # see documentation in linux/drivers/char/random.c test "$VERBOSE" != no && echo "Saving random seed..." umask 077 dd if=/dev/urandom of=/var/lib/urandom/random-seed count=1 \ >/dev/null 2>&1 || echo "urandom stop: failed." ;; *) echo "Usage: urandom {start|stop}" >&2 exit 1 ;; esac exit 0 070701002EC83F000081ED00000000000000000000000147CEEAEA00000055000000080000001100000000000000000000001800000000etc/init.d/alignment.sh#!/bin/sh if [ -e /proc/cpu/alignment ]; then echo "3" > /proc/cpu/alignment fi 070701002EC840000081ED00000000000000000000000147CEEAEA00000377000000080000001100000000000000000000001700000000etc/init.d/mountall.sh# # mountall.sh Mount all filesystems. # # Version: @(#)mountall.sh 2.83-2 01-Nov-2001 miquels@cistron.nl # . /etc/default/rcS # # Mount local filesystems in /etc/fstab. For some reason, people # might want to mount "proc" several times, and mount -v complains # about this. So we mount "proc" filesystems without -v. # test "$VERBOSE" != no && echo "Mounting local filesystems..." mount -at nonfs,nosmbfs,noncpfs 2>/dev/null # # We might have mounted something over /dev, see if /dev/initctl is there. # if test ! -p /dev/initctl then rm -f /dev/initctl mknod -m 600 /dev/initctl p fi kill -USR1 1 # # Execute swapon command again, in case we want to swap to # a file on a now mounted filesystem. # doswap=yes case "`uname -r`" in 2.[0123].*) if grep -qs resync /proc/mdstat then doswap=no fi ;; esac if test $doswap = yes then swapon -a 2> /dev/null fi : exit 0 070701002EC891000081ED00000000000000000000000147CEEAEF000003C8000000080000001100000000000000000000000F00000000etc/init.d/rcS#!/bin/sh # # rcS Call all S??* scripts in /etc/rcS.d in # numerical/alphabetical order. # # Version: @(#)/etc/init.d/rcS 2.76 19-Apr-1999 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin runlevel=S prevlevel=N umask 022 export PATH runlevel prevlevel # Make sure proc is mounted # [ -d "/proc/1" ] || mount /proc # # See if system needs to be setup. This is ONLY meant to # be used for the initial setup after a fresh installation! # if [ -x /sbin/unconfigured.sh ] then /sbin/unconfigured.sh fi # # Source defaults. # . /etc/default/rcS # # Trap CTRL-C &c only in this shell so we can interrupt subprocesses. # trap ":" INT QUIT TSTP # # Call all parts in order. # exec /etc/init.d/rc S # # For compatibility, run the files in /etc/rc.boot too. # [ -d /etc/rc.boot ] && run-parts /etc/rc.boot # # Finish setup if needed. The comment above about # /sbin/unconfigured.sh applies here as well! # if [ -x /sbin/setup.sh ] then /sbin/setup.sh fi 070701002EC841000081ED00000000000000000000000147CEEAEA000001A3000000080000001100000000000000000000001000000000etc/init.d/halt#! /bin/sh # # halt Execute the halt command. # # Version: @(#)halt 2.84-2 07-Jan-2002 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin # See if we need to cut the power. if test -x /etc/init.d/ups-monitor then /etc/init.d/ups-monitor poweroff fi # Don't shut down drives if we're using RAID. hddown="-h" if grep -qs '^md.*active' /proc/mdstat then hddown="" fi halt -d -f -i -p $hddown : exit 0 070701002EC8C9000081ED00000000000000000000000147CEEB61000015ED000000080000001100000000000000000000001000000000etc/init.d/udev#!/bin/sh -e ### BEGIN INIT INFO # Provides: udev # Required-Start: mountvirtfs # Required-Stop: # Default-Start: S # Default-Stop: # Short-Description: Start udevd, populate /dev and load drivers. ### END INIT INFO # we need to unmount /dev/pts/ and remount it later over the tmpfs unmount_devpts() { if mountpoint -q /dev/pts/; then umount -l /dev/pts/ fi if mountpoint -q /dev/shm/; then umount -l /dev/shm/ fi } # mount a tmpfs over /dev, if somebody did not already do it mount_tmpfs() { if grep -E -q "^[^[:space:]]+ /dev tmpfs" /proc/mounts; then return fi # /dev/.static/dev/ is used by MAKEDEV to access the real /dev/ directory. # /etc/udev/ is recycled as a temporary mount point because it's the only # directory which is guaranteed to be available. mount -n -o bind /dev /etc/udev if ! mount -n -o size=$tmpfs_size,mode=0755 -t tmpfs tmpfs /dev; then umount /etc/udev echo "udev requires tmpfs support, not started." exit 1 fi mkdir -p /dev/.static/dev chmod 700 /dev/.static/ # The mount options in busybox are non-standard... if test -x /bin/mount.util-linux then /bin/mount.util-linux --move /etc/udev /dev/.static/dev elif test -x /bin/busybox then busybox mount -n -o move /etc/udev /dev/.static/dev else echo "udev requires an identifiable mount command, not started." umount /etc/udev umount /dev exit 1 fi } # I hate this hack. -- Md make_extra_nodes() { if [ "$(echo /lib/udev/devices/*)" != "/lib/udev/devices/*" ]; then cp -a /lib/udev/devices/* /dev/ fi [ -e /etc/udev/links.conf ] || return 0 grep '^[^#]' /etc/udev/links.conf | \ while read type name arg1; do [ "$type" -a "$name" -a ! -e "/dev/$name" -a ! -L "/dev/$name" ] ||continue case "$type" in L) ln -s $arg1 /dev/$name ;; D) mkdir -p /dev/$name ;; M) mknod -m 600 /dev/$name $arg1 ;; *) echo "links.conf: unparseable line ($type $name $arg1)" ;; esac done } supported_kernel() { case "$(uname -r)" in 2.[012345].*|2.6.[0-9]|2.6.[0-9][!0-9]*) return 1 ;; 2.6.1[01]|2.6.1[01][!0-9]*) return 1 ;; esac return 0 } set_hotplug_handler() { case "$(uname -r)" in 2.6.1[0-4]|2.6.1[0-4][!0-9]*) HANDLER='/sbin/udevsend' ;; esac echo $HANDLER > /proc/sys/kernel/hotplug } # shell version of /usr/bin/tty my_tty() { [ -x /bin/readlink ] || return 0 [ -e /proc/self/fd/0 ] || return 0 readlink --silent /proc/self/fd/0 || true } warn_if_interactive() { if [ "$RUNLEVEL" = "S" -a "$PREVLEVEL" = "N" ]; then return fi TTY=$(my_tty) if [ -z "$TTY" -o "$TTY" = "/dev/console" ]; then return fi printf "\n\n\nIt has been detected that the command\n\n\t$0 $*\n\n" printf "has been run from an interactive shell.\n" printf "It will probably not do what you expect, so this script will wait\n" printf "60 seconds before continuing. Press ^C to stop it.\n" printf "RUNNING THIS COMMAND IS HIGHLY DISCOURAGED!\n\n\n\n" sleep 60 } ############################################################################## PATH="/sbin:/bin:/usr/bin" [ -x /sbin/udevd ] || exit 0 # defaults tmpfs_size="10M" udev_root="/dev" udevd_timeout=30 . /etc/udev/udev.conf if ! supported_kernel; then echo "udev requires a kernel >= 2.6.12, not started." exit 1 fi if [ ! -e /proc/filesystems ]; then echo "udev requires a mounted procfs, not started." exit 1 fi if ! grep -q '[[:space:]]tmpfs$' /proc/filesystems; then echo "udev requires tmpfs support, not started." exit 1 fi if [ ! -d /sys/class/ ]; then echo "udev requires a mounted sysfs, not started." exit 1 fi if [ ! -e /proc/sys/kernel/hotplug ]; then echo "udev requires hotplug support, not started." exit 1 fi ############################################################################## # When modifying this script, do not forget that between the time that # the new /dev has been mounted and udevsynthesize has been run there will be # no /dev/null. This also means that you cannot use the "&" shell command. case "$1" in start) if [ -e "$udev_root/.udev/" ]; then if mountpoint -q /dev/; then TMPFS_MOUNTED=1 else echo ".udev/ already exists on the static $udev_root!" fi else warn_if_interactive fi echo "Starting the hotplug events dispatcher" "udevd" udevd --daemon set_hotplug_handler if [ -z "$TMPFS_MOUNTED" ]; then unmount_devpts mount_tmpfs [ -d /proc/1 ] || mount -n /proc fi # if this directory is not present /dev will not be updated by udev mkdir -p /dev/.udev/ /dev/.udev/db/ /dev/.udev/queue/ /dev/.udevdb/ # /dev/null must be created before udevd is started make_extra_nodes echo "Synthesizing the initial hotplug events" udevtrigger # wait for the udevd childs to finish echo "Waiting for /dev to be fully populated" while [ -d /dev/.udev/queue/ ]; do sleep 1 udevd_timeout=$(($udevd_timeout - 1)) if [ $udevd_timeout -eq 0 ]; then # ps axf break fi done if [ $udevd_timeout -eq 0 ]; then echo 'timeout' fi ;; stop) echo "Stopping the hotplug events dispatcher" "udevd" start-stop-daemon --stop --name udevd --quiet ;; restart|force-reload) echo "Stopping the hotplug events dispatcher" "udevd" if start-stop-daemon --stop --name udevd --quiet ; then exit 1 fi echo "Starting the hotplug events dispatcher" "udevd" udevd --daemon ;; *) echo "Usage: /etc/init.d/udev {start|stop|restart|force-reload}" exit 1 ;; esac exit 0 070701002EC842000081ED00000000000000000000000147CEEAEA000000A2000000080000001100000000000000000000001700000000etc/init.d/hostname.sh# # hostname.sh Set hostname. # # Version: @(#)hostname.sh 1.10 26-Feb-2001 miquels@cistron.nl # if test -f /etc/hostname then hostname -F /etc/hostname fi 070701002EC843000081ED00000000000000000000000147CEEAEA00000106000000080000001100000000000000000000001500000000etc/init.d/rmnologin#! /bin/sh # # rmnologin This script removes the /etc/nologin file as the last # step in the boot process. # # Version: @(#)rmnologin 1.00 22-Jun-1998 miquels@cistron.nl # if test -f /etc/nologin.boot then rm -f /etc/nologin /etc/nologin.boot fi : exit 0 070701002EC844000081ED00000000000000000000000147CEEAEA00000635000000080000001100000000000000000000001700000000etc/init.d/mountnfs.sh# # mountnfs.sh Now that TCP/IP is configured, mount the NFS file # systems in /etc/fstab if needed. If possible, # start the portmapper before mounting (this is needed for # Linux 2.1.x and up). # # Also mounts SBM filesystems now, so the name of # this script is getting increasingly inaccurate. # # Version: @(#)mountnfs.sh 2.83 05-Oct-2001 miquels@cistron.nl # . /etc/default/rcS # # Run in a subshell because of I/O redirection. # test -f /etc/fstab && ( # # Read through fstab line by line. If it is NFS, set the flag # for mounting NFS filesystems. If any NFS partition is found and it # not mounted with the nolock option, we start the portmapper. # portmap=no mount_nfs=no mount_smb=no mount_ncp=no while read device mountpt fstype options do case "$device" in ""|\#*) continue ;; esac case "$options" in *noauto*) continue ;; esac if test "$fstype" = nfs then mount_nfs=yes case "$options" in *nolock*) ;; *) portmap=yes ;; esac fi if test "$fstype" = smbfs then mount_smb=yes fi if test "$fstype" = ncpfs then mount_ncp=yes fi done exec 0>&1 if test "$portmap" = yes then if test -x /sbin/portmap then echo -n "Starting portmapper... " start-stop-daemon --start --quiet --exec /sbin/portmap sleep 2 fi fi if test "$mount_nfs" = yes || test "$mount_smb" = yes || test "$mount_ncp" = yes then echo "Mounting remote filesystems..." test "$mount_nfs" = yes && mount -a -t nfs test "$mount_smb" = yes && mount -a -t smbfs test "$mount_ncp" = yes && mount -a -t ncpfs fi ) < /etc/fstab : exit 0 070701002EC845000081ED00000000000000000000000147CEEAEA00000127000000080000001100000000000000000000001400000000etc/init.d/umountfs#! /bin/sh # # umountfs Turn off swap and unmount all local filesystems. # PATH=/sbin:/bin:/usr/sbin:/usr/bin echo "Deactivating swap..." swapoff -a # We leave /proc mounted. echo "Unmounting local filesystems..." mount -o remount,ro /mnt/ram umount -f -a -r mount -o remount,ro / : exit 0 070701002EC846000081ED00000000000000000000000147CEEAEA0000068D000000080000001100000000000000000000001700000000etc/init.d/bootmisc.sh# # bootmisc.sh Miscellaneous things to be done during bootup. # . /etc/default/rcS # # Put a nologin file in /etc to prevent people from logging in before # system startup is complete. # if test "$DELAYLOGIN" = yes then echo "System bootup in progress - please wait" > /etc/nologin cp /etc/nologin /etc/nologin.boot fi # # Set pseudo-terminal access permissions. # if ( ! grep -q devfs /proc/mounts ) && test -c /dev/ttyp0 then chmod 666 /dev/tty[p-za-e][0-9a-f] chown root:tty /dev/tty[p-za-e][0-9a-f] fi # # Apply /proc settings if defined # SYSCTL_CONF="/etc/sysctl.conf" if [ -f "${SYSCTL_CONF}" ] then if [ -x "/sbin/sysctl" ] then /sbin/sysctl -p "${SYSCTL_CONF}" else echo "To have ${SYSCTL_CONF} applied during boot, install package ." fi fi # # Update /etc/motd. # if test "$EDITMOTD" != no then uname -a > /etc/motd.tmp sed 1d /etc/motd >> /etc/motd.tmp mv /etc/motd.tmp /etc/motd fi # # This is as good a place as any for a sanity check # /tmp should be a symlink to /var/tmp to cut down on the number # of mounted ramdisks. if test ! -L /tmp && test -d /var/tmp then rm -rf /tmp ln -sf /var/tmp /tmp fi # Set the system clock from hardware clock # If the timestamp is 1 day or more recent than the current time, # use the timestamp instead. /etc/init.d/hwclock.sh start if test -e /etc/timestamp then SYSTEMDATE=`date "+%Y%m%d"` TIMESTAMP=`cat /etc/timestamp | awk '{ print substr($0,9,4) substr($0,1,4);}'` NEEDUPDATE=`expr \( $TIMESTAMP \> $SYSTEMDATE \)` if [ $NEEDUPDATE -eq 1 ]; then date `cat /etc/timestamp` /etc/init.d/hwclock.sh stop fi fi : exit 0 070701002EC847000081ED00000000000000000000000147CEEAEA00000F00000000080000001100000000000000000000002000000000etc/init.d/populate-volatile.sh#!/bin/sh . /etc/default/rcS CFGDIR="/etc/default/volatiles" TMPROOT="/var/tmp" COREDEF="00_core" [ "${VERBOSE}" != "no" ] && echo "Populating volatile Filesystems." check_requirements() { cleanup() { rm "${TMP_INTERMED}" rm "${TMP_DEFINED}" rm "${TMP_COMBINED}" } CFGFILE="$1" [ `basename "${CFGFILE}"` = "${COREDEF}" ] && return 0 TMP_INTERMED="${TMPROOT}/tmp.$$" TMP_DEFINED="${TMPROOT}/tmpdefined.$$" TMP_COMBINED="${TMPROOT}/tmpcombined.$$" cat /etc/passwd | sed 's@\(^:\)*:.*@\1@' | sort | uniq > "${TMP_DEFINED}" cat ${CFGFILE} | grep -v "^#" | cut -d " " -f 2 > "${TMP_INTERMED}" cat "${TMP_DEFINED}" "${TMP_INTERMED}" | sort | uniq > "${TMP_COMBINED}" NR_DEFINED_USERS="`cat "${TMP_DEFINED}" | wc -l`" NR_COMBINED_USERS="`cat "${TMP_COMBINED}" | wc -l`" [ "${NR_DEFINED_USERS}" -ne "${NR_COMBINED_USERS}" ] && { echo "Undefined users:" diff "${TMP_DEFINED}" "${TMP_COMBINED}" | grep "^>" cleanup return 1 } cat /etc/group | sed 's@\(^:\)*:.*@\1@' | sort | uniq > "${TMP_DEFINED}" cat ${CFGFILE} | grep -v "^#" | cut -d " " -f 3 > "${TMP_INTERMED}" cat "${TMP_DEFINED}" "${TMP_INTERMED}" | sort | uniq > "${TMP_COMBINED}" NR_DEFINED_GROUPS="`cat "${TMP_DEFINED}" | wc -l`" NR_COMBINED_GROUPS="`cat "${TMP_COMBINED}" | wc -l`" [ "${NR_DEFINED_GROUPS}" -ne "${NR_COMBINED_GROUPS}" ] && { echo "Undefined groups:" diff "${TMP_DEFINED}" "${TMP_COMBINED}" | grep "^>" cleanup return 1 } # Add checks for required directories here cleanup return 0 } apply_cfgfile() { CFGFILE="$1" check_requirements "${CFGFILE}" || { echo "Skipping ${CFGFILE}" return 1 } cat ${CFGFILE} | grep -v "^#" | \ while read LINE; do TTYPE=`echo ${LINE} | cut -d " " -f 1` TUSER=`echo ${LINE} | cut -d " " -f 2` TGROUP=`echo ${LINE} | cut -d " " -f 3` TMODE=`echo ${LINE} | cut -d " " -f 4` TNAME=`echo ${LINE} | cut -d " " -f 5` [ "${VERBOSE}" != "no" ] && echo "Checking for -${TNAME}-." [ "${TTYPE}" = "l" ] && { [ -e "${TNAME}" ] && { echo "Cannot create link over existing -${TNAME}-." >&2 } || { TSOURCE=`echo ${LINE} | cut -d " " -f 6` [ "${VERBOSE}" != "no" ] && echo "Creating link -${TNAME}- pointing to -${TSOURCE}-." ln -s "${TSOURCE}" "${TNAME}" } continue } [ -L "${TNAME}" ] && { [ "${VERBOSE}" != "no" ] && echo "Found link." NEWNAME=`ls -l "${TNAME}" | sed -e 's/^.*-> \(.*\)$/\1/'` echo ${NEWNAME} | grep -v "^/" >/dev/null && { TNAME="`echo ${TNAME} | sed -e 's@\(.*\)/.*@\1@'`/${NEWNAME}" [ "${VERBOSE}" != "no" ] && echo "Converted relative linktarget to absolute path -${TNAME}-." } || { TNAME="${NEWNAME}" [ "${VERBOSE}" != "no" ] && echo "Using absolute link target -${TNAME}-." } } [ -e "${TNAME}" ] && { [ "${VERBOSE}" != "no" ] && echo "Target already exists. Skipping." continue } case "${TTYPE}" in "f") [ "${VERBOSE}" != "no" ] && echo "Creating file -${TNAME}-." touch "${TNAME}" ;; "d") [ "${VERBOSE}" != "no" ] && echo "Creating directory -${TNAME}-." mkdir -p "${TNAME}" # Add check to see if there's an entry in fstab to mount. ;; *) [ "${VERBOSE}" != "no" ] && echo "Invalid type -${TTYPE}-." continue ;; esac chown ${TUSER} ${TNAME} || echo "Failed to set owner -${TUSER}- for -${TNAME}-." >&2 chgrp ${TGROUP} ${TNAME} || echo "Failed to set group -${TGROUP}- for -${TNAME}-." >&2 chmod ${TMODE} ${TNAME} || echo "Failed to set mode -${TMODE}- for -${TNAME}-." >&2 done return 0 } for file in `ls -1 "${CFGDIR}" | sort`; do apply_cfgfile "${CFGDIR}/${file}" done 070701002EC848000081ED00000000000000000000000147CEEAEA000001E9000000080000001100000000000000000000001800000000etc/init.d/umountnfs.sh#! /bin/sh # # umountnfs.sh Unmount all network filesystems. # PATH=/sbin:/bin:/usr/sbin:/usr/bin # Write a reboot record to /var/log/wtmp before unmounting halt -w echo "Unmounting remote filesystems..." test -f /etc/fstab && ( # # Read through fstab line by line and unount network file systems # while read device mountpt fstype options do if test "$fstype" = nfs || test "$fstype" = smbfs || test "$fstype" = ncpfs then umount -f $mountpt fi done ) < /etc/fstab : exit 0 070701002EC849000081ED00000000000000000000000147CEEAEA00000065000000080000001100000000000000000000001700000000etc/init.d/save-rtc.sh#! /bin/sh /etc/init.d/hwclock.sh stop # Update the timestamp date +%2m%2d%2H%2M%Y > /etc/timestamp 070701002EC871000081ED00000000000000000000000147CEEAEA000009F4000000080000001100000000000000000000001600000000etc/init.d/networking#!/bin/sh # # manage network interfaces and configure some networking options PATH=/usr/local/sbin:/usr/local/bin:/sbin:/bin:/usr/sbin:/usr/bin if ! [ -x /sbin/ifup ]; then exit 0 fi spoofprotect_rp_filter () { # This is the best method: turn on Source Address Verification and get # spoof protection on all current and future interfaces. if [ -e /proc/sys/net/ipv4/conf/all/rp_filter ]; then for f in /proc/sys/net/ipv4/conf/*; do [ -e $f/rp_filter ] && echo 1 > $f/rp_filter done return 0 else return 1 fi } spoofprotect () { echo -n "Setting up IP spoofing protection: " if spoofprotect_rp_filter; then echo "rp_filter." else echo "FAILED." fi } ip_forward () { if [ -e /proc/sys/net/ipv4/ip_forward ]; then echo -n "Enabling packet forwarding... " echo 1 > /proc/sys/net/ipv4/ip_forward echo "done." fi } syncookies () { if [ -e /proc/sys/net/ipv4/tcp_syncookies ]; then echo -n "Enabling TCP/IP SYN cookies... " echo 1 > /proc/sys/net/ipv4/tcp_syncookies echo "done." fi } doopt () { optname=$1 default=$2 opt=`grep "^$optname=" /etc/network/options` if [ -z "$opt" ]; then opt="$optname=$default" fi optval=${opt#$optname=} if [ "$optval" = "yes" ]; then eval $optname fi } case "$1" in start) doopt spoofprotect yes doopt syncookies no doopt ip_forward no echo -n "Configuring network interfaces... " ifup -a echo "done." ;; stop) if sed -n 's/^[^ ]* \([^ ]*\) \([^ ]*\) .*$/\1 \2/p' /proc/mounts | grep -q "^/ nfs$"; then echo "NOT deconfiguring network interfaces: / is an NFS mount" elif sed -n 's/^[^ ]* \([^ ]*\) \([^ ]*\) .*$/\1 \2/p' /proc/mounts | grep -q "^/ smbfs$"; then echo "NOT deconfiguring network interfaces: / is an SMB mount" elif sed -n 's/^[^ ]* \([^ ]*\) \([^ ]*\) .*$/\2/p' /proc/mounts | grep -qE '^(nfs|smbfs|ncp|coda)$'; then echo "NOT deconfiguring network interfaces: network shares still mounted." else echo -n "Deconfiguring network interfaces... " ifdown -a echo "done." fi ;; force-reload|restart) echo -n "Reconfiguring network interfaces... " ifdown -a ifup -a echo "done." ;; *) echo "Usage: /etc/init.d/networking {start|stop|restart|force-reload}" exit 1 ;; esac exit 0 070701002EC805000081ED00000000000000000000000147CEEB0400000600000000080000001100000000000000000000001200000000etc/init.d/syslog#! /bin/sh # # syslog init.d script for busybox syslogd/klogd # Written by Robert Griebl # Configuration file added by set -e if [ -f /etc/syslog.conf ]; then . /etc/syslog.conf LOG_LOCAL=0 LOG_REMOTE=0 for D in $DESTINATION; do if [ "$D" = "buffer" ]; then SYSLOG_ARGS="$SYSLOG_ARGS -C $BUFFERSIZE" LOG_LOCAL=1 elif [ "$D" = "file" ]; then if [ -n "$LOGFILE" ]; then SYSLOG_ARGS="$SYSLOG_ARGS -O $LOGFILE" fi if [ -n "$ROTATESIZE" ]; then SYSLOG_ARGS="$SYSLOG_ARGS -s $ROTATESIZE" fi if [ -n "$ROTATEGENS" ]; then SYSLOG_ARGS="$SYSLOG_ARGS -b $ROTATEGENS" fi LOCAL=0 elif [ "$D" = "remote" ]; then SYSLOG_ARGS="$SYSLOG_ARGS -R $REMOTE" LOG_REMOTE=1 fi done if [ "$LOG_LOCAL" = "1" -a "$LOG_REMOTE" = "1" ]; then SYSLOG_ARGS="$SYSLOG_ARGS -L" fi if [ -n "$MARKINT" ]; then SYSLOG_ARGS="$SYSLOG_ARGS -m $MARKINT" fi if [ "$REDUCE" = "yes" ]; then SYSLOG_ARGS="$SYSLOG_ARGS -S" fi else # default: log to 16K shm circular buffer SYSLOG_ARGS="-C" fi case "$1" in start) echo -n "Starting syslogd/klogd: " start-stop-daemon -S -b -n syslogd -a /sbin/syslogd -- -n $SYSLOG_ARGS start-stop-daemon -S -b -n klogd -a /sbin/klogd -- -n echo "done" ;; stop) echo -n "Stopping syslogd/klogd: " start-stop-daemon -K -n syslogd start-stop-daemon -K -n klogd echo "done" ;; restart) $0 stop $0 start ;; *) echo "Usage: syslog { start | stop | restart }" >&2 exit 1 ;; esac exit 0 070701002EC84A000081ED00000000000000000000000147CEEAEA00000EC2000000080000001100000000000000000000001800000000etc/init.d/checkroot.sh# # checkroot.sh Check to root filesystem. # # Version: @(#)checkroot.sh 2.84 25-Jan-2002 miquels@cistron.nl # . /etc/default/rcS # # Set SULOGIN in /etc/default/rcS to yes if you want a sulogin to be spawned # from this script *before anything else* with a timeout, like SCO does. # test "$SULOGIN" = yes && sulogin -t 30 $CONSOLE # # Ensure that bdflush (update) is running before any major I/O is # performed (the following fsck is a good example of such activity :). # test -x /sbin/update && update # # Read /etc/fstab. # exec 9>&0 &9 9>&- # # Activate the swap device(s) in /etc/fstab. This needs to be done # before fsck, since fsck can be quite memory-hungry. # doswap=no test -d /proc/1 || mount -n /proc case "`uname -r`" in 2.[0123].*) if test $swap_on_md = yes && grep -qs resync /proc/mdstat then test "$VERBOSE" != no && echo "Not activating swap - RAID array resyncing" else doswap=yes fi ;; *) doswap=yes ;; esac if test $doswap = yes then test "$VERBOSE" != no && echo "Activating swap" swapon -a 2> /dev/null fi # # Check the root filesystem. # if test -f /fastboot || test $rootcheck = no then test $rootcheck = yes && echo "Fast boot, no filesystem check" else # # Ensure that root is quiescent and read-only before fsck'ing. # mount -n -o remount,ro / if test $? = 0 then if test -f /forcefsck then force="-f" else force="" fi if test "$FSCKFIX" = yes then fix="-y" else fix="-a" fi spinner="-C" case "$TERM" in dumb|network|unknown|"") spinner="" ;; esac test `uname -m` = s390 && spinner="" # This should go away test "$VERBOSE" != no && echo "Checking root filesystem..." fsck $spinner $force $fix / # # If there was a failure, drop into single-user mode. # # NOTE: "failure" is defined as exiting with a return code of # 2 or larger. A return code of 1 indicates that filesystem # errors were corrected but that the boot may proceed. # if test "$?" -gt 1 then # Surprise! Re-directing from a HERE document (as in # "cat << EOF") won't work, because the root is read-only. echo echo "fsck failed. Please repair manually and reboot. Please note" echo "that the root filesystem is currently mounted read-only. To" echo "remount it read-write:" echo echo " # mount -n -o remount,rw /" echo echo "CONTROL-D will exit from this shell and REBOOT the system." echo # Start a single user shell on the console /sbin/sulogin $CONSOLE reboot -f fi else echo "*** ERROR! Cannot fsck root fs because it is not mounted read-only!" echo fi fi # # If the root filesystem was not marked as read-only in /etc/fstab, # remount the rootfs rw but do not try to change mtab because it # is on a ro fs until the remount succeeded. Then clean up old mtabs # and finally write the new mtab. # mount -n -o remount,$rootmode / if test "$rootmode" = rw then if test ! -L /etc/mtab then rm -f /etc/mtab~ /etc/nologin : > /etc/mtab fi mount -f -o remount / mount -f /proc test "$devfs" && grep -q '^devfs /dev' /proc/mounts && mount -f "$devfs" fi : exit 0 070701002EC84B000081ED00000000000000000000000147CEEAEA00000125000000080000001100000000000000000000001200000000etc/init.d/banner#!/bin/sh if [ ! -e /dev/tty ]; then /bin/mknod -m 0666 /dev/tty c 5 0 fi if ( > /dev/tty0 ) 2>/dev/null; then vtmaster=/dev/tty0 elif ( > /dev/vc/0 ) 2>/dev/null; then vtmaster=/dev/vc/0 else vtmaster=/dev/null fi echo > $vtmaster echo "Please wait: booting..." > $vtmaster 070701002EC84C000081ED00000000000000000000000147CEEAEA00000144000000080000001100000000000000000000001400000000etc/init.d/sendsigs#! /bin/sh # # sendsigs Kill all remaining processes. # # Version: @(#)sendsigs 2.75 22-Jun-1998 miquels@cistron.nl # PATH=/sbin:/bin:/usr/sbin:/usr/bin # Kill all processes. echo "Sending all processes the TERM signal..." killall5 -15 sleep 5 echo "Sending all processes the KILL signal..." killall5 -9 : exit 0 070701002EC84D000081ED00000000000000000000000147CEEAEA0000071E000000080000001100000000000000000000001300000000etc/init.d/devices#!/bin/sh # # Devfs handling script. Since we arent running devfsd due to various reasons # which I will not lay out here, we need to create some links for compatibility. . /etc/default/rcS # exit without doing anything if udev is active if test -e /dev/.udev -o -e /dev/.udevdb; then exit 0 fi if test -e /dev/.devfsd then if test "$VERBOSE" != "no"; then echo -n "Setting up device links for devfs: "; fi ln -s /dev/touchscreen/0 /dev/ts ln -s /dev/touchscreen/0raw /dev/tsraw ln -s /dev/vc/0 /dev/tty0 ln -s /dev/vc/1 /dev/tty1 ln -s /dev/vc/2 /dev/tty2 ln -s /dev/vc/3 /dev/tty3 ln -s /dev/vc/4 /dev/tty4 ln -s /dev/vc/5 /dev/tty5 ln -s /dev/fb/0 /dev/fb0 # ln -s /dev/tts/0 /dev/ttySA0 # ln -s /dev/tts/1 /dev/ttySA1 # ln -s /dev/tts/2 /dev/ttySA2 ln -s /dev/sound/dsp /dev/dsp ln -s /dev/sound/mixer /dev/mixer ln -s /dev/v4l/video0 /dev/video0 ln -s /dev/v4l/video0 /dev/video ln -s /dev/misc/rtc /dev/rtc ## need this so that ppp will autoload the ppp modules mknod /dev/ppp c 108 0 if test "$VERBOSE" != "no"; then echo "done"; fi else if test "$VERBOSE" != "no"; then echo -n "Mounting /dev ramdisk: "; fi mount -t ramfs ramfs /dev || mount -t tmpfs ramfs /dev if test $? -ne 0; then if test "$VERBOSE" != "no"; then echo "failed"; fi else if test "$VERBOSE" != "no"; then echo "done"; fi fi if test "$VERBOSE" != "no"; then echo -n "Populating /dev: "; fi cd / mkdir -p dev/input mkdir -p dev/msys mkdir -p dev/pts mkdir -p dev/vc mkdir -p dev/snd for i in 0 1 2 3 4 5 6 7 8 9; do ln -s /dev/tty$i /dev/vc/$i done ln -sf /proc/self/fd /dev/fd ln -sf /proc/kcore /dev/core /sbin/makedevs -r / -D /etc/device_table if test $? -ne 0; then if test "$VERBOSE" != "no"; then echo "failed"; fi else if test "$VERBOSE" != "no"; then echo "done"; fi fi fi exit 0 070701002EC7C9000081A400000000000000000000000147CEEAEA00000000000000080000001100000000000000000000000900000000etc/motd070701002EC80C000041ED00000000000000000000000247CEFAFD00000000000000080000001100000000000000000000000A00000000etc/rc6.d070701002ECE020000A1FF00000000000000000000000147CEFAFD00000014000000080000001100000000000000000000001800000000etc/rc6.d/K40networking../init.d/networking070701002EC84E0000A1FF00000000000000000000000147CEFADB00000015000000080000001100000000000000000000001900000000etc/rc6.d/S25save-rtc.sh../init.d/save-rtc.sh070701002EC84F0000A1FF00000000000000000000000147CEFADB00000012000000080000001100000000000000000000001600000000etc/rc6.d/S20sendsigs../init.d/sendsigs070701002ECE060000A1FF00000000000000000000000147CEFAFD00000010000000080000001100000000000000000000001400000000etc/rc6.d/K20syslog../init.d/syslog070701002EC7E00000A1FF00000000000000000000000147CEFADB00000010000000080000001100000000000000000000001400000000etc/rc6.d/S90reboot../init.d/reboot070701002EC8500000A1FF00000000000000000000000147CEFADB00000012000000080000001100000000000000000000001600000000etc/rc6.d/S40umountfs../init.d/umountfs070701002EC8510000A1FF00000000000000000000000147CEFADB00000016000000080000001100000000000000000000001A00000000etc/rc6.d/S31umountnfs.sh../init.d/umountnfs.sh070701002EC7CA000041ED00000000000000000000000247CEEAEC00000000000000080000001100000000000000000000000400000000sys07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000B00000000TRAILER!!!