gvim-9.1.1176-150500.20.24.2<>, gDp9|\ildJ^)08/#7a;)4wI; S0| ĔXawOHobyr9rG ߻C;@Mrz) uwzWtJZ>'yDPȮX`_#X U(s8j>dg>H?d  ,8<HLe R0 n  (  x  * P  . ..dhm(q8x90:!>(@0B8FTGlHIdXYZt[\] 0^ (b c d e f l "u 8v wxy4z`ptzCgvim9.1.1176150500.20.24.2A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.gDh02-armsrv2MwSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxaarch64/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiKx)U C.&F,A큤gDgDgDgDgDgDgDgDgDgDgDgDgDgDgDgDgDgDgDgȱgDgDgDgDgDgDgDgDgDgDgD530cf475647b9c2016a08c23f931e58b7aebbdb9b30c01953cfea2675401ad4c761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a82010b200a5bad2d5fa2c286b89091cdbc57e1e7bea771121b6b941dc656dc46fa3a6eec36bce6a7817e62c4b15940ab1b42af19292b7ed37d42e268d2c9131b2db708795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0b0685688fa3eabffad030fb2450faff870a4db4fb3179b4bf87b1853cb625b001d203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa09051e24f1bdf0a66bc7c3d3bb811c5229dbe789119d4dde535a1b92872090cb8f7f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f225bbc8b1988690ddf5be1c0cd1847d3128da54cfd66787308238e7825ee36988cb498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.1.1176-150500.20.24.2.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(aarch-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.28)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.17)(64bit)libm.so.6(GLIBC_2.29)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)libselinux.so.1()(64bit)libselinux.so.1(LIBSELINUX_1.0)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.1.1176-150500.20.24.23.0.4-14.6.0-14.0-15.2-19.1.1176-150500.20.24.2gvim8.24.14.3g͂ggb@gH[@f$eqe]@dܺ@dx@dldZ5dJcd'@ccR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@martin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Introduce patch to fix bsc#1235751 (regression). * vim-9.1.1134-revert-putty-terminal-colors.patch - Update to 9.1.1176. Changes: * 9.1.1176: wrong indent when expanding multiple lines * 9.1.1175: inconsistent behaviour with exclusive selection and motion commands * 9.1.1174: tests: Test_complete_cmdline() may fail * 9.1.1173: filetype: ABNF files are not detected * 9.1.1172: [security]: overflow with 'nostartofline' and Ex command in tag file * 9.1.1171: tests: wrong arguments passed to assert_equal() * 9.1.1170: wildmenu highlighting in popup can be improved * 9.1.1169: using global variable for get_insert()/get_lambda_name() * 9.1.1168: wrong flags passed down to nextwild() * 9.1.1167: mark '] wrong after copying text object * 9.1.1166: command-line auto-completion hard with wildmenu * 9.1.1165: diff: regression with multi-file diff blocks * 9.1.1164: [security]: code execution with tar.vim and special crafted tar files * 9.1.1163: $MYVIMDIR is set too late * 9.1.1162: completion popup not cleared in cmdline * 9.1.1161: preinsert requires bot "menu" and "menuone" to be set * 9.1.1160: Ctrl-Y does not work well with "preinsert" when completing items * 9.1.1159: $MYVIMDIR may not always be set * 9.1.1158: :verbose set has wrong file name with :compiler! * 9.1.1157: command completion wrong for input() * 9.1.1156: tests: No test for what patch 9.1.1152 fixes * 9.1.1155: Mode message not cleared after :silent message * 9.1.1154: Vim9: not able to use autoload class accross scripts * 9.1.1153: build error on Haiku * 9.1.1152: Patch v9.1.1151 causes problems * 9.1.1151: too many strlen() calls in getchar.c * 9.1.1150: :hi completion may complete to wrong value * 9.1.1149: Unix Makefile does not support Brazilian lang for the installer * 9.1.1148: Vim9: finding imported scripts can be further improved * 9.1.1147: preview-window does not scroll correctly * 9.1.1146: Vim9: wrong context being used when evaluating class member * 9.1.1145: multi-line completion has wrong indentation for last line * 9.1.1144: no way to create raw strings from a blob * 9.1.1143: illegal memory access when putting a register * 9.1.1142: tests: test_startup fails if $HOME/$XDG_CONFIG_HOME is defined * 9.1.1141: Misplaced comment in readfile() * 9.1.1140: filetype: m17ndb files are not detected * 9.1.1139: [fifo] is not displayed when editing a fifo * 9.1.1138: cmdline completion for :hi is too simplistic * 9.1.1137: ins_str() is inefficient by calling STRLEN() * 9.1.1136: Match highlighting marks a buffer region as changed * 9.1.1135: 'suffixesadd' doesn't work with multiple items * 9.1.1134: filetype: Guile init file not recognized * 9.1.1133: filetype: xkb files not recognized everywhere * 9.1.1132: Mark positions wrong after triggering multiline completion * 9.1.1131: potential out-of-memory issue in search.c * 9.1.1130: 'listchars' "precedes" is not drawn on Tabs. * 9.1.1129: missing out-of-memory test in buf_write() * 9.1.1128: patch 9.1.1119 caused a regression with imports * 9.1.1127: preinsert text is not cleaned up correctly * 9.1.1126: patch 9.1.1121 used a wrong way to handle enter * 9.1.1125: cannot loop through pum menu with multiline items * 9.1.1124: No test for 'listchars' "precedes" with double-width char * 9.1.1123: popup hi groups not falling back to defaults * 9.1.1122: too many strlen() calls in findfile.c * 9.1.1121: Enter does not insert newline with "noselect" * 9.1.1120: tests: Test_registers fails * 9.1.1119: Vim9: Not able to use an autoloaded class from another autoloaded script * 9.1.1118: tests: test_termcodes fails * 9.1.1117: there are a few minor style issues * 9.1.1116: Vim9: super not supported in lambda expressions * 9.1.1115: [security]: use-after-free in str_to_reg() * 9.1.1114: enabling termguicolors automatically confuses users * 9.1.1113: tests: Test_terminal_builtin_without_gui waits 2 seconds * 9.1.1112: Inconsistencies in get_next_or_prev_match() * 9.1.1111: Vim9: variable not found in transitive import * 9.1.1110: Vim tests are slow and flaky * 9.1.1109: cmdexpand.c hard to read * 9.1.1108: 'smoothscroll' gets stuck with 'listchars' "eol" * 9.1.1107: cannot loop through completion menu with fuzzy * 9.1.1106: tests: Test_log_nonexistent() causes asan failure * 9.1.1105: Vim9: no support for protected new() method * 9.1.1104: CI: using Ubuntu 22.04 Github runners * 9.1.1103: if_perl: still some compile errors with Perl 5.38 * 9.1.1102: tests: Test_WinScrolled_Resized_eiw() uses wrong filename- 9.1.1101 is a fix for: bsc#1229685 (CVE-2024-43790) bsc#1229822 (CVE-2024-43802) bsc#1230078 (CVE-2024-45306) bsc#1235695 (CVE-2025-22134) bsc#1236151 (CVE-2025-24014) bsc#1237137 (CVE-2025-1215) - Remove obsoleted patch: * vim-7.3-mktemp_tutor.patch - update to 9.1.1101 * insexpand.c hard to read * tests: Test_log_nonexistent only works on Linux * Update base-syntax, improve variable matching * Vim9: import with extends may crash * leaking memory with completing multi lines * --log with non-existent path causes a crash * if_perl: Perl 5.38 adds new symbols causing link failure * tests: matchparen plugin test wrongly named * Vim9: problem finding implemented method in type hierarchy * runtime(qf): Update syntax file, match second delimiter * tests: output of test ...win32_ctrl_z depends on python version * tests: fix expected return code for python 3.13 on Windows * tests: timeout might be a bit too small * tests: test_terminwscroll_topline2 unreliable * tests: No check when tests are run under Github actions * tests: plugin tests are named inconsistently * Vim9: import with extends may crash * completion doesn't work with multi lines * filetype: cmmt files are not recognized * Unable to persistently ignore events in a window and its buffers * improve syntax highlighting * setreg() doesn't correctly handle mbyte chars in blockwise mode * unexpected DCS responses may cause out of bounds reads * has('bsd') is true for GNU/Hurd * filetype: Mill files are not recognized * GUI late startup leads to uninitialized scrollbars * Add support for lz4 to tar & gzip plugin * Terminal ansi colors off by one after tgc reset * included syntax items do not understand contains=TOP * vim_strnchr() is strange and unnecessary * Vim9: len variable not used in compile_load() * runtime(vim): Update base-syntax, match :debuggreedy count prefix * Strange error when heredoc marker starts with "trim" * tests: test_compiler fails on Windows without Maven * 'diffopt' "linematch" cannot be used with {n} less than 10 * args missing after failing to redefine a function * Cannot control cursor positioning of getchar() * preinsert text completions not deleted with / * getchar() can't distinguish between C-I and Tab * tests: Test_termwinscroll_topline2 fails on MacOS * heap-use-after-free and stack-use-after-scope with :14verbose * no digraph for "Approaches the limit" * not possible to use plural forms with gettext() * too many strlen() calls in userfunc.c * terminal: E315 when dragging the terminal with the mouse * runtime(openPlugin): fix unclosed parenthesis in GetWordUnderCursor() * runtime(doc): Tweak documentation style a bit * tests: test_glvs fails when unarchiver not available * Vim always enables 'termguicolors' in a terminal * completion: input text deleted with preinsert when adding leader * translation(sr): Missing Serbian translation for the tutor * Superfluous cleanup steps in test_ins_complete.vim * runtime(netrw): correct wrong version check * Vim doesn't highlight to be inserted text when completing * runtime(netrw): upstream snapshot of v176 * runtime(dist/vim9): fix regressions in dist#vim9#Open * runtime(hyprlang): fix string recognition * make install fails because of a missing dependency * runtime(asm): add byte directives to syntax script * Vim doesn't work well with TERM=xterm-direct * runtime(filetype): commit 99181205c5f8284a3 breaks V lang detection * runtime: decouple Open and Launch commands and gx mapping from netrw * "nosort" enables fuzzy filtering even if "fuzzy" isn't in 'completeopt' * runtime(just): fix typo in syntax file * runtime(filetype): Improve Verilog detection by checking for modules definition * tests: off-by-one error in CheckCWD in test_debugger.vim * tests: no support for env variables when running Vim in terminal * too many strlen() calls in os_unix.c * insert-completed items are always sorted * crash after scrolling and pasting in silent Ex mode * Makefiles uses non-portable syntax * fuzzymatching doesn't prefer matching camelcase * filetype: N-Tripels and TriG files are not recognized * Vim9: Patch 9.1.1014 causes regressions * translation(sr): Update Serbian messages translation - updade to 9.1.1043 * [security]: segfault in win_line() * update helptags * filetype: just files are not recognized * Update base-syntax, match ternary and falsy operators * Vim9: out-of-bound access when echoing an enum * Vim9: imported type cannot be used as func return type * runtime(kconfig): updated ftplugin and syntax script * runtime(doc): rename last t_BG reference to t_RB * Vim9: comments are outdated * tests: test_channel.py fails with IPv6 * runtime(vim): Update base-syntax, fix is/isnot operator matching * Vim9: confusing error when using abstract method via super * make install fails when using shadowdir * Vim9: memory leak with blob2str() * runtime(tex): add texEmphStyle to texMatchGroup in syntax script * runtime(netrw): upstream snapshot of v175 * Vim9: compiling abstract method fails without return * runtime(c): add new constexpr keyword to syntax file (C23) * tests: shaderslang was removed from test_filetype erroneously * link error when FEAT_SPELL not defined * Coverity complains about insecure data handling * runtime(sh): update syntax script * runtime(c): Add missing syntax test files * filetype: setting bash filetype is backwards incompatible * runtime(c): Update syntax and ftplugin files * the installer can be improved * too many strlen() calls in screen.c * no sanitize check when running linematch * filetype: swc configuration files are not recognized * runtime(netrw): change netrw maintainer * wrong return type of blob2str() * blob2str/str2blob() do not support list of strings * runtime(doc): fix typo in usr_02.txt * Coverity complains about dereferencing NULL pointer * linematch option value not completed * string might be used without a trailing NUL * no way to get current selected item in a async context * filetype: fd ignore files are not recognized * v9.1.0743 causes regression with diff mode * runtime(doc): fix base64 encode/decode examples * Vim9: Patch 9.1.1013 causes a few problems * Not possible to convert string2blob and blob2string * Coverity complains about dereferencing NULL value * Vim9: variable not found in transitive import * runtime(colors): Update colorschemes, include new unokai colorscheme * Vim9: Regression caused by patch v9.1.0646 * runtime(lyrics): support milliseconds in syntax script * runtime(vim): Split Vim legacy and Vim9 script indent tests * Vim9: class interface inheritance not correctly working * popupmenu internal error with some abbr in completion item * filetype: VisualCode setting file not recognized * diff feature can be improved * tests: test for patch 9.1.1006 doesn't fail without the patch * filetype: various ignore are not recognized * tests: Load screendump files with "git vimdumps" * PmenuMatch completion highlight can be combined * completion text is highlighted even with no pattern found * tests: a few termdebug tests are flaky * [security]: heap-buffer-overflow with visual mode * runtime(doc): add package- helptags for included packages * Vim9: unknown func error with interface declaring func var * runtime(filetype): don't detect string interpolation as angular * ComplMatchIns highlight hard to read on light background * runtime(vim): Update base-syntax, highlight literal string quote escape * runtime(editorconfig): set omnifunc to syntaxcomplete func * tests: ruby tests fail with Ruby 3.4 * Vim9: leaking finished exception * runtime(tiasm): use correct syntax name tiasm in syntax script * filetype: TI assembly files are not recognized * too many strlen() calls in drawscreen.c * runtime(xf86conf): add section name OutputClass to syntax script * ComplMatchIns may highlight wrong text * runtime(vim): Update base-syntax, improve ex-bang matching * runtime(doc): clarify buffer deletion on popup_close() * filetype: shaderslang files are not detected * Vim9: not able to use comment after opening curly brace - update to 9.1.0993 * 9.1.0993: New 'cmdheight' behavior may be surprising * runtime(sh): fix typo in Last Change header * 9.1.0992: Vim9: double-free after v9.1.0988 * 9.1.0991: v:stacktrace has wrong type in Vim9 script * runtime(sh): add PS0 to bashSpecialVariables in syntax script * runtime(vim): Remove trailing comma from match_words * runtime(zsh): sync syntax script with upstream repo * runtime(doc): Capitalise the mnemonic "Zero" for the 'z' flag of search() * 9.1.0990: Inconsistent behavior when changing cmdheight * 9.1.0989: Vim9: Whitespace after the final enum value causes a syntax error * runtime(java): Quietly opt out for unsupported markdown.vim versions * runtime(vim): fix failing vim syntax test * 9.1.0988: Vim9: no error when using uninitialized var in new() * runtime(doc): update index.txt * 9.1.0987: filetype: cake files are not recognized * 9.1.0986: filetype: 'jj' filetype is a bit imprecise * runtime(jj): Support diffs in jj syntax * runtime(vim): Update matchit pattern, no Vim9 short names * 9.1.0985: Vim9: some ex commands can be shortened * 9.1.0984: exception handling can be improved * runtime(doc): update doc for :horizontal * runtime(doc): update index.txt, windows.txt and version9.txt * runtime(doc): Tweak documentation about base64 function * runtime(chordpro): update syntax script * 9.1.0983: not able to get the displayed items in complete_info() * runtime(doc): use standard SGR format at :h xterm-true-color * 9.1.0982: TI linker files are not recognized * runtime(vim): update vim generator syntax script * 9.1.0981: tests: typo in test_filetype.vim * 9.1.0980: no support for base64 en-/decoding functions in Vim Script * syntax(sh): Improve the recognition of bracket expressions * runtime(doc): mention how NUL bytes are handled * 9.1.0979: VMS: type warning with $XDG_VIMRC_FILE * 9.1.0978: GUI tests sometimes fail when setting 'scroll' options * 9.1.0977: filetype: msbuild filetypes are not recognized * 9.1.0976: Vim9: missing return statement with throw * 9.1.0975: Vim9: interpolated string expr not working in object methods * 9.1.0974: typo in change of commit v9.1.0873 * 9.1.0973: too many strlen() calls in fileio.c * runtime(sh): set shellcheck as the compiler for supported shells * runtime(doc): Fix enum example syntax * 9.1.0972: filetype: TI linker map files are not recognized * runtime(vim): Improve syntax script generator for Vim Script * 9.1.0971: filetype: SLNX files are not recognized * 9.1.0970: VMS: build errors on VMS architecture * runtime(doc): Fix documentation typos * runtime(doc): update for new keyprotocol option value (after v9.1.0969) * 9.1.0969: ghostty not using kitty protocol by default * 9.1.0968: tests: GetFileNameChecks() isn't fully sorted by filetype name * runtime(doc): update version9.txt for bash filetype * runtime(netrw): update last change header for #16265 * runtime(doc): fix doc error in :r behaviour * 9.1.0967: SpotBugs compiler setup can be further improved * 9.1.0966: Vim9: :enum command can be shortened * runtime(compiler): include a basic bash syntax checker compiler * 9.1.0965: filetype: sh filetype set when detecting the use of bash * runtime(doc): clarify ARCH value for 32-bit in INSTALLpc.txt * 9.1.0963: fuzzy-matching does not prefer full match * 9.1.0962: filetype: bun.lock file is not recognized * runtime(vim): update indentation plugin for Vim script * runtime(doc): tweak documentation style in helphelp.txt * runtime(vim): Update base-syntax, allow parens in default arguments * runtime(doc): mention auto-format using clang-format for sound.c/sign.c * runtime(help): fix typo s/additional/arbitrary/ * runtime(help): Add better support for language annotation highlighting * 9.1.0961: filetype: TI gel files are not recognized * 9.1.0960: filetype: hy history files are not recognized * translation(fi): Fix typoes in Finish menu translation * 9.1.0959: Coverity complains about type conversion * runtime(vim): Use supported syntax in indent tests * 9.1.0958: filetype: supertux2 config files detected as lisp * 9.1.0956: completion may crash, completion highlight wrong with preview window * 9.1.0955: Vim9: vim9compile.c can be further improved * runtime(doc): move help tag E1182 * runtime(graphql): contribute vim-graphql to Vim core * 9.1.0954: popupmenu.c can be improved * 9.1.0953: filetype: APKBUILD files not correctly detected * 9.1.0952: Vim9: missing type checking for any type assignment * 9.1.0951: filetype: jshell files are not recognized * runtime(dockerfile): do not set commentstring in syntax script * 9.1.0950: filetype: fennelrc files are not recognized * runtime(netrw): do not double escape Vim special characters * git: ignore reformatting change of netrw plugin * runtime(netrw): more reformating #16248 * runtime(doc): Add a note about handling symbolic links in starting.txt * 9.1.0949: popups inconsistently shifted to the left * git: ignore reformatting change of netrw plugin * runtime(netrw): change indent size from 1 to 2 * 9.1.0948: Missing cmdline completion for :pbuffer * runtime(tutor): Reformat tutor1 * 9.1.0947: short-description * 9.1.0946: cross-compiling fails on osx-arm64 * 9.1.0945: ComplMatchIns highlight doesn't end after inserted text * translation(sv): re-include the change from #16240 * 9.1.0944: tests: test_registers fails when not run under X11 * 9.1.0943: Vim9: vim9compile.c can be further improved * runtime(doc): Update README and mention make check to verify * translation(sv): partly revert commit 98874dca6d0b60ccd6fc3a140b3ec * runtime(vim): update base-syntax after v9.1.0936 * 9.1.0942: a few typos were found * 9.1.0941: ComplMatchIns doesn't work after multibyte chars * runtime(doc): Fix style in fold.txt * translation(sv): Fix typo in Swedish translation * 9.1.0940: Wrong cursor shape with "gq" and 'indentexpr' executes :normal * runtime(doc): fix some small errors * 9.1.0939: make installtutor fails * 9.1.0938: exclusive selection not respected when re-selecting block mode * 9.1.0937: test_undolist() is flaky * 9.1.0936: cannot highlight completed text * 9.1.0935: SpotBugs compiler can be improved * 9.1.0934: hard to view an existing buffer in the preview window * runtime(doc): document how to minimize fold computation costs * 9.1.0933: Vim9: vim9compile.c can be further improved * 9.1.0932: new Italian tutor not installed * runtime(doc): fix a few minor errors from the last doc updates * translation(it): add Italian translation for the interactive tutor * runtime(doc): update the change.txt help file * runtime(help): Add Vim lang annotation support for codeblocks * 9.1.0931: ml_get error in terminal buffer * 9.1.0930: tests: test_terminal2 may hang in GUI mode * 9.1.0929: filetype: lalrpop files are not recognized * 9.1.0928: tests: test_popupwin fails because the filter command fails * editorconfig: set trim_trailing_whitespace = false for src/testdir/test*.vim * 9.1.0927: style issues in insexpand.c * 9.1.0926: filetype: Pixi lock files are not recognized * runtime(doc): Add a reference to |++opt| and |+cmd| at `:h :pedit` * runtime(doc): add a note about inclusive motions and exclusive selection * 9.1.0925: Vim9: expression compiled when not necessary * 9.1.0924: patch 9.1.0923 causes issues * 9.1.0923: too many strlen() calls in filepath.c * 9.1.0923: wrong MIN macro in popupmenu.c * 9.1.0921: popupmenu logic is a bit convoluted * 9.1.0920: Vim9: compile_assignment() too long * 9.1.0919: filetype: some assembler files are not recognized * runtime(netrw): do not pollute search history with symlinks * 9.1.0918: tiny Vim crashes with fuzzy buffer completion * 9.1.0917: various vartabstop and shiftround bugs when shifting lines * runtime(typst): add definition lists to formatlistpat, update maintainer * 9.1.0916: messages.c is exceeding 80 columns * runtime(proto): include filetype plugin for protobuf * 9.1.0915: GVim: default font size a bit too small * 9.1.0914: Vim9: compile_assignment() is too long * 9.1.0913: no error check for neg values for 'messagesopt' * runtime(netrw): only check first arg of netrw_browsex_viewer for being executable * 9.1.0912: xxd: integer overflow with sparse files and -autoskip * 9.1.0911: Variable name for 'messagesopt' doesn't match short name * 9.1.0910: 'messagesopt' does not check max wait time * runtime(doc): update wrong Vietnamese localization tag * 9.1.0909: Vim9: crash when calling instance method - update to 9.1.0908 * refresh vim-7.3-mktemp_tutor.patch * 9.1.0908: not possible to configure :messages * 9.1.0907: printoptions:portrait does not change postscript Orientation * runtime(doc): Add vietnamese.txt to helps main TOC * 9.1.0906: filetype: Nvidia PTX files are not recognized * runtime(doc): updated version9.txt with changes from v9.1.0905 * 9.1.0905: Missing information in CompleteDone event * 9.1.0904: Vim9: copy-paste error in class_defining_member() * 9.1.0903: potential overflow in spell_soundfold_wsal() * runtime(netrw): do not detach when launching external programs in gvim * runtime(doc): make tag alignment more consistent in filetype.txt * runtime(doc): fix wrong syntax and style of vietnamese.txt * translation(it): update Italian manpage for vimtutor * runtime(lua): add optional lua function folding * Filelist: include translations for Chapter 2 tutor * translation(vi): Update Vietnamese translation * runtime(doc): include vietnamese.txt * runtime(tutor): fix another typo in tutor2 * runtime(doc): fix typo in vimtutor manpage * translation(it): update Italian manpage for vimtutor * translation(it): include Italian version of tutor chapter 2 * runtime(tutor): regenerated some translated tutor1 files * runtime(tutor): fix typo in Chapter 2 * 9.1.0902: filetype: Conda configuration files are not recognized * runtime(doc): Tweak documentation style a bit * runtime(tutor): update the tutor files and re-number the chapters * runtime(tutor): Update the makefiles for tutor1 and tutor2 files * 9.1.0901: MS-Windows: vimtutor batch script can be improved * runtime(doc): remove buffer-local completeopt todo item * 9.1.0900: Vim9: digraph_getlist() does not accept bool arg * runtime(typst): provide a formatlistpat in ftplugin * runtime(doc): Update documentation for "noselect" in 'completeopt' * 9.1.0899: default for 'backspace' can be set in C code * runtime(helptoc): reload cached g:helptoc.shell_prompt when starting toc * translation(ru): Updated messages translation * 9.1.0898: runtime(compiler): pytest compiler not included * 9.1.0897: filetype: pyrex files are not detected * runtime(compiler): update eslint compiler * 9.1.0896: completion list wrong after v9.1.0891 * runtime(doc): document changed default value for 'history' * 9.1.0895: default history value is too small * 9.1.0894: No test for what the spotbug compiler parses * 9.1.0893: No test that undofile format does not regress * translation(de): update German manpages * runtime(compiler): include spotbugs Java linter * 9.1.0892: the max value of 'tabheight' is limited by other tabpages * runtime(po): remove poDiffOld/New, add po-format flags to syntax file * 9.1.0891: building the completion list array is inefficient * patch 9.1.0890: %! item not allowed for 'rulerformat' * runtime(gzip): load undofile if there exists one * 9.1.0889: Possible unnecessary redraw after adding/deleting lines * 9.1.0888: leftcol property not available in getwininfo() * 9.1.0887: Wrong expression in sign.c * 9.1.0886: filetype: debian control file not detected * runtime(c3): include c3 filetype plugin * 9.1.0885: style of sign.c can be improved * 9.1.0884: gcc warns about uninitialized variable * runtime(apache): Update syntax directives for apache server 2.4.62 * translation(ru): updated vimtutor translation, update MAINTAINERS file * 9.1.0883: message history cleanup is missing some tests * runtime(doc): Expand docs on :! vs. :term * runtime(netrw): Fixing powershell execution issues on Windows * 9.1.0882: too many strlen() calls in insexpand.c * 9.1.0881: GUI: message dialog may not get focus * runtime(netrw): update netrw's decompress logic * runtime(apache): Update syntax keyword definition * runtime(misc): add Italian LICENSE and (top-level) README file * 9.1.0880: filetype: C3 files are not recognized * runtime(doc): add helptag for :HelpToc command * 9.1.0879: source is not consistently formatted * Add clang-format config file * runtime(compiler): fix escaping of arguments passed to :CompilerSet * 9.1.0878: termdebug: cannot enable DEBUG mode * 9.1.0877: tests: missing test for termdebug + decimal signs * 9.1.0876: filetype: openCL files are not recognized * 9.1.0875: filetype: hyprlang detection can be improved * 9.1.0874: filetype: karel files are not detected * 9.1.0873: filetype: Vivado files are not recognized * 9.1.0872: No test for W23 message * 9.1.0871: getcellpixels() can be further improved * 9.1.0870: too many strlen() calls in eval.c * 9.1.0869: Problem: curswant not set on gm in folded line * 9.1.0868: the warning about missing clipboard can be improved * runtime(doc): Makefile does not clean up all temporary files * 9.1.0867: ins_compl_add() has too many args * editorconfig: don't trim trailing whitespaces in runtime/doc * translation(am): Remove duplicate keys in desktop files * runtime(doc): update helptags * runtime(filetype): remove duplicated *.org file pattern * runtime(cfg): only consider leading // as starting a comment * 9.1.0866: filetype: LLVM IR files are not recognized * 9.1.0865: filetype: org files are not recognized * 9.1.0864: message history is fixed to 200 * 9.1.0863: getcellpixels() can be further improved * runtime(sh): better function support for bash/zsh in indent script * runtime(netrw): small fixes to netrw#BrowseX * 9.1.0862: 'wildmenu' not enabled by default in nocp mode * runtime(doc): update how to report issues for mac Vim * runtime(doc): mention option-backslash at :h CompilerSet * runtime(compiler): include a Java Maven compiler plugin * runtime(racket): update Racket runtime files * runtime(doc): improve indentation in examples for netrw-handler * runtime(doc): improve examples for netrw-handler functions * runtime(idris2): include filetype,indent+syntax plugins for (L)Idris2 + ipkg * runtime(doc): clarify the use of filters and external commands * 9.1.0861: Vim9: no runtime check for object member access of any var * runtime(compiler): update pylint linter * 9.1.0860: tests: mouse_shape tests use hard code sleep value * 9.1.0859: several problems with the GLVS plugin * 9.1.0858: Coverity complains about dead code * runtime(tar): Update tar.vim to support permissions * 9.1.0857: xxd: --- is incorrectly recognized as end-of-options * 9.1.0851: too many strlen() calls in getchar.c * 9.1.0850: Vim9: cannot access nested object inside objects * runtime(tex): extra Number highlighting causes issues * runtime(vim): Fix indent after :silent! function * 9.1.0849: there are a few typos in the source * runtime(netrw): directory symlink not resolved in tree view * runtime(doc): add a table of supported Operating Systems * runtime(tex): update Last Change header in syntax script * runtime(doc): fix typo in g:termdebug_config * runtime(vim): Update base-syntax, improve :normal highlighting * runtime(tex): add Number highlighting to syntax file * runtime(doc): Tweak documentation style a bit * 9.1.0848: if_lua: v:false/v:true are not evaluated to boolean * runtime(dune): use :setl instead of :set in ftplugin * runtime(termdebug): allow to use decimal signs * translation(it): Updated Italian vimtutor * runtime(compiler): improve cppcheck * git: git-blame-ignore-revs shown as an error on Github * 9.1.0847: tests: test_popupwin fails because of updated help file * 9.1.0846: debug symbols for xxd are not cleaned in Makefile * runtime(structurizr): Update structurizr syntax * runtime(8th): updated 8th syntax * runtime(doc): Add pi_tutor.txt to help TOC * runtime(compiler): add mypy and ruff compiler; update pylint linter * runtime(netrw): fix several bugs in netrw tree listing * runtime(netrw): prevent polluting the search history * 9.1.0845: vimtutor shell script can be improved * 9.1.0844: if_python: no way to pass local vars to python * 9.1.0843: too many strlen() calls in undo.c * runtime(doc): update default value for fillchars option * runtime(compiler): fix typo in cppcheck compiler plugin * runtime(doc): simplify vimtutor manpage a bit more * runtime(matchparen): Add matchparen_disable_cursor_hl config option * 9.1.0842: not checking for the sync() systemcall * 9.1.0841: tests: still preferring python2 over python3 * 9.1.0840: filetype: idris2 files are not recognized * 9.1.0839: filetype: leo files are not recognized * runtime(cook): include cook filetype plugin * runtime(debversions): Update Debian versions * patch 9.1.0838: vimtutor is bash-specific * runtime(doc): add help specific modeline to pi_tutor.txt * Filelist: vimtutor chapter 2 is missing in Filelist * 9.1.0837: cross-compiling has some issues * runtime(vimtutor): Add a second chapter- Fix for bsc#1234333 / bsc#1234214 / bsc#1234245. These three bugs all have the same root cause: Package 'xxd' has been obsoleted by Vim, as it provides the xxd files directly. However, because the "Obsoletes" entry was versioned, depending on which version of 'xxd' that is installed, the "Obsoletes" isn't actually triggered. Thus, there is a conflict between "vim" and "xxd" in these cases. Fixing this by removing the version completely. The 'vim' package should always replace 'xxd', even if people are migrating from an older SLE15 service pack which has the exact same version.- Fix for bsc#1231373 / CVE-2024-47814. - Fix for bsc#1229238 / CVE-2024-43374. - update to 9.1.0836 * 9.1.0836: The vimtutor can be improved * 9.1.0835: :setglobal doesn't work properly for 'ffu' and 'tsrfu' * 9.1.0834: tests: 2html test fails * 9.1.0833: CI: recent ASAN changes do not work for indent tests * 9.1.0832: :set doesn't work for 'cot' and 'bkc' after :setlocal * runtime(doc): update help-toc description * runtime(2html): Make links use color scheme colors in TOhtml * 9.1.0831: 'findexpr' can't be used as lambad or Funcref * Filelist: include helptoc package * runtime(doc): include a TOC Vim9 plugin * Filelist: ignore .git-blame-ignore-revs * 9.1.0830: using wrong highlight group for spaces for popupmenu * runtime(typst): synchronize updates from the upstream typst.vim * git: ignore reformatting commit for git-blame (after v9.1.0829) * 9.1.0829: Vim source code uses a mix of tabs and spaces * 9.1.0828: string_T struct could be used more often * 9.1.0827: CI: tests can be improved * runtime(doc): remove stray sentence in pi_netrw.txt * 9.1.0826: filetype: sway files are not recognized * runtime(doc): Include netrw-gp in TOC * runtime(doc): mention 'iskeyword' at :h charclass() * runtime(doc): update help tags * 9.1.0825: compile error for non-diff builds * runtime(netrw): fix E874 when browsing remote directory which contains `~` character * runtime(doc): update coding style documentation * runtime(debversions): Add plucky (25.04) as Ubuntu release name * 9.1.0824: too many strlen() calls in register.c * 9.1.0823: filetype: Zephyr overlay files not recognized * runtime(doc): Clean up minor formatting issues for builtin functions * runtime(netrw): make :Launch/Open autoloadable * runtime(netrw): fix regression with x mapping on Cygwin * runtime(netrw): fix filetype detection for remote files * 9.1.0822: topline might be changed in diff mode unexpectedly * CI: huge linux builds should also run syntax & indent tests * 9.1.0821: 'findexpr' completion doesn't set v:fname to cmdline argument * 9.1.0820: tests: Mac OS tests are too flaky * runtime(awk): Highlight more awk comments in syntax script * runtime(netrw): add missing change for s:redir() * 9.1.0819: tests: using findexpr and imported func not tested * runtime(netrw): improve netrw's open-handling further * runtime(netrw): fix syntax error in netrwPlugin.vim * runtime(netrw): simplify gx file handling * 9.1.0818: some global functions are only used in single files * 9.1.0817: termdebug: cannot evaluate expr in a popup * runtime(defaults): Detect putty terminal and switch to dark background * 9.1.0816: tests: not clear what tests cause asan failures * runtime(doc): Remove some completed items from todo.txt * 9.1.0815: "above" virtual text causes wrong 'colorcolumn' position * runtime(syntax-tests): tiny vim fails because of line-continuation * 9.1.0814: mapset() may remove unrelated mapping * 9.1.0813: no error handling with setglobal and number types * 9.1.0812: Coverity warns about dereferencing NULL ptr * 9.1.0811: :find expansion does not consider 'findexpr' * 9.1.0810: cannot easily adjust the |:find| command * 9.1.0809: filetype: petalinux config files not recognized * 9.1.0808: Terminal scrollback doesn't shrink when decreasing 'termwinscroll' * 9.1.0807: tests: having 'nolist' in modelines isn't always desired * 9.1.0806: tests: no error check when setting global 'briopt' * 9.1.0805: tests: minor issues in gen_opt_test.vim * 9.1.0804: tests: no error check when setting global 'cc' * 9.1.0803: tests: no error check when setting global 'isk' * 9.1.0802: tests: no error check when setting global 'fdm' to empty value * 9.1.0801: tests: no error check when setting global 'termwinkey' * 9.1.0800: tests: no error check when setting global 'termwinsize' * runtime(doc): :ownsyntax also resets 'spelloptions' * 9.1.0799: tests: gettwinvar()/gettabwinvar() tests are not comprehensive * runtime(doc): Fix wrong Mac default options * 9.1.0798: too many strlen() calls in cmdhist.c * 9.1.0797: testing of options can be further improved * 9.1.0796: filetype: libtool files are not recognized * (typst): add folding to typst ftplugin * runtime(netrw): deprecate and remove netrwFileHandlers#Invoke() * 9.1.0795: filetype: Vivado memory info file are not recognized * 9.1.0794: tests: tests may fail on Windows environment * runtime(doc): improve the :colorscheme documentation * 9.1.0793: xxd: -e does add one extra space * 9.1.0792: tests: Test_set_values() is not comprehensive enough * runtime(swayconfig): add flag for bindsym/bindcode to syntax script * 9.1.0791: tests: errors in gen_opt_test.vim are not shown * runtime(compiler): check for compile_commands in build dirs for cppcheck * 9.1.0790: Amiga: AmigaOS4 build should use default runtime (newlib) * runtime(help): Update help syntax * runtime(help): fix end of sentence highlight in code examples * runtime(jinja): Support jinja syntax as secondary filetype * 9.1.0789: tests: ':resize + 5' has invalid space after '+' * 9.1.0788: 27;u is not decoded to literal Escape in kitty/foot * 9.1.0787: cursor position changed when using hidden terminal * 9.1.0786: tests: quickfix update test does not test location list * runtime(doc): add some docs for file-watcher programs * CI: uploading failed screendumps still fails on Cirrus CI * 9.1.0785: cannot preserve error position when setting quickfix list * 9.1.0784: there are several problems with python 3.13 * 9.1.0783: 'spell' option setting has problems * 9.1.0782: tests: using wrong neomuttlog file name * runtime(doc): add preview flag to statusline example * 9.1.0781: tests: test_filetype fails * 9.1.0780: MS-Windows: incorrect Win32 error checking * 9.1.0779: filetype: neomuttlog files are not recognized * 9.1.0778: filetype: lf config files are not recognized * runtime(comment): fix commment toggle with mixed tabs & spaces * runtime(misc): Use consistent "Vim script" spelling * runtime(gleam): add ftplugin for gleam files * runtime(doc): link help-writing from write-local-help * 9.1.0777: filetype: Some upstream php files are not recognized * runtime(java): Define javaBlockStart and javaBlockOtherStart hl groups * runtime(doc): mention conversion rules for remote_expr() * runtime(tutor): Fix missing :s command in spanish translation section 4.4 * 9.1.0776: test_strftime may fail because of missing TZ data * translation(am): Add Armenian language translation * 9.1.0775: tests: not enough tests for setting options * 9.1.0774: "shellcmdline" doesn't work with getcompletion() * 9.1.0773: filetype: some Apache files are not recognized * 9.1.0772: some missing changes from v9.1.0771 * 9.1.0771: completion attribute hl_group is confusing * 9.1.0770: current command line completion is a bit limited * 9.1.0769: filetype: MLIR files are not recognized * 9.1.0768: MS-Windows: incorrect cursor position when restoring screen * runtime(nasm): Update nasm syntax script * 9.1.0767: A condition is always true in ex_getln.c * runtime(skill): Update syntax file to fix string escapes * runtime(help): highlight CTRL- correctly * runtime(doc): add missing usr_52 entry to toc * 9.1.0766: too many strlen() calls in ex_getln.c * runtime(doc): correct `vi` registers 1-9 documentation error * 9.1.0765: No test for patches 6.2.418 and 7.3.489 * runtime(spec): set comments and commentstring options * NSIS: Include libgcc_s_sjlj-1.dll again * runtime(doc): clarify the effect of 'startofline' option * 9.1.0764: [security]: use-after-free when closing a buffer * runtime(vim): Update base-syntax file, improve class, enum and interface highlighting * 9.1.0763: tests: cannot run single syntax tests * 9.1.0762: 'cedit', 'termwinkey' and 'wildchar' may not be parsed correctly * 9.1.0761: :cd completion fails on Windows with backslash in path * 9.1.0760: tests: no error reported, if gen_opt_test.vim fails * 9.1.0759: screenpos() may return invalid position * runtime(misc): unset compiler in various ftplugins * runtime(doc): update formatting and syntax * runtime(compiler): add cppcheck linter compiler plugin * runtime(doc): Fix style in documents * runtime(doc): Fix to two-space convention in user manual * runtime(comment): consider &tabstop in lines after whitespace indent * 9.1.0758: it's possible to set an invalid key to 'wildcharm' * runtime(java): Manage circularity for every :syn-included syntax file * 9.1.0757: tests: messages files contains ANSI escape sequences * 9.1.0756: missing change from patch v9.1.0754 * 9.1.0755: quickfix list does not handle hardlinks well * runtime(doc): 'filetype', 'syntax' and 'keymap' only allow alphanumeric + some characters * runtime(systemd): small fixes to &keywordprg in ftplugin * CI: macos-12 runner is being sunset, switch to 13 * 9.1.0754: fixed order of items in insert-mode completion menu * runtime(comment): commenting might be off by one column * 9.1.0753: Wrong display when typing in diff mode with 'smoothscroll' * 9.1.0752: can set 'cedit' to an invalid value * runtime(doc): add `usr` tag to usr_toc.txt * 9.1.0751: Error callback for term_start() not used * 9.1.0750: there are some Win9x legacy references * runtime(java): Recognise the CommonMark form (///) of Javadoc comments * 9.1.0749: filetype: http files not recognized * runtime(comment): fix syntax error * CI: uploading failed screendump tests does not work Cirrus * 9.1.0748: :keep* commmands are sometimes misidentified as :k * runtime(indent): allow matching negative numbers for gnu indent config file * runtime(comment): add gC mapping to (un)comment rest of line * 9.1.0747: various typos in repo found * 9.1.0746: tests: Test_halfpage_longline() fails on large terminals * runtime(doc): reformat gnat example * runtime(doc): reformat ada_standard_types section * 9.1.0745: filetype: bun and deno history files not recognized * runtime(glvs): Correct the tag name of glvs-autoinstal * runtime(doc): include short form for :earlier/:later * runtime(doc): remove completed TODO * 9.1.0744: filetype: notmuch configs are not recognised * 9.1.0743: diff mode does not handle overlapping diffs correctly * runtime(glvs): fix a few issues * runtime(doc): Fix typo in :help :command-modifiers * 9.1.0742: getcmdprompt() implementation can be improved * runtime(docs): update `:set?` command behavior table * runtime(doc): update vim90 to vim91 in docs * runtime(doc): fix typo in :h dos-colors * 9.1.0741: No way to get prompt for input()/confirm() * runtime(doc): fix typo in version9.txt nrformat -> nrformats * runtime(rmd,rrst): 'fex' option not properly restored * runtime(netrw): remove extraneous closing bracket * 9.1.0740: incorrect internal diff with empty file * 9.1.0739: [security]: use-after-free in ex_getln.c * runtime(filetype): tests: Test_filetype_detection() fails * runtime(dist): do not output a message if executable is not found * 9.1.0738: filetype: rapid files are not recognized * runtime(modconf): remove erroneous :endif in ftplugin * runtime(lyrics): support multiple timestamps in syntax script * runtime(java): Optionally recognise _module_ import declarations * runtime(vim): Update base-syntax, improve folding function matches * CI: upload failed screendump tests also for Cirrus * 9.1.0737: tests: screendump tests may require a bit more time * runtime(misc): simplify keywordprg in various ftplugins * runtime(java): Optionally recognise all primitive constants in _switch-case_ labels * runtime(zsh,sh): set and unset compiler in ftplugin * runtime(netrw): using inefficient highlight pattern for 'mf' * 9.1.0736: Unicode tables are outdated * 9.1.0735: filetype: salt files are not recognized * 9.1.0734: filetype: jinja files are not recognized * runtime(zathurarc): add double-click-follow to syntax script * translation(ru): Updated messages translation * translation(it): updated xxd man page * translation(ru): updated xxd man page * 9.1.0733: keyword completion does not work with fuzzy * 9.1.0732: xxd: cannot use -b and -i together * runtime(java): Highlight javaConceptKind modifiers with StorageClass * runtime(doc): reword and reformat how to use defaults.vim * 9.1.0731: inconsistent case sensitive extension matching * runtime(vim): Update base-syntax, match Vim9 bool/null literal args to :if/:while/:return * runtime(netrw): delete confirmation not strict enough * 9.1.0730: Crash with cursor-screenline and narrow window * 9.1.0729: Wrong cursor-screenline when resizing window * 9.1.0728: [security]: heap-use-after-free in garbage collection with location list user data * runtime(doc): clarify the effect of the timeout for search()-functions * runtime(idlang): update syntax script * runtime(spec): Recognize epoch when making spec changelog in ftplugin * runtime(spec): add file triggers to syntax script * 9.1.0727: too many strlen() calls in option.c * runtime(make): add compiler/make.vim to reset compiler plugin settings * runtime(java): Recognise all available standard doclet tags * 9.1.0726: not using correct python3 API with dynamic linking * runtime(dosini): Update syntax script, spellcheck comments only * runtime(doc): Revert outdated comment in completeopt's fuzzy documentation * 9.1.0725: filetype: swiftinterface files are not recognized * runtime(pandoc): Update compiler plugin to use actual 'spelllang' * runtime(groff): Add compiler plugin for groff * 9.1.0724: if_python: link error with python 3.13 and stable ABI * 9.1.0723: if_python: dynamic linking fails with python3 >= 3.13 * 9.1.0722: crash with large id in text_prop interface * 9.1.0721: tests: test_mksession does not consider XDG_CONFIG_HOME * runtime(glvs): update GetLatestVimScripts plugin * runtime(doc): Fix typo in :help :hide text * runtime(doc): buffers can be re-used * 9.1.0720: Wrong breakindentopt=list:-1 with multibyte or TABs * 9.1.0719: Resetting cell widths can make 'listchars' or 'fillchars' invalid * runtime(doc): Update version9.txt and mention $MYVIMDIR - Update to 9.1.0718: * v9.1.0718: hard to know the users personal Vim Runtime Directory * v9.1.0717: Unnecessary nextcmd NULL checks in parse_command_modifiers() Maintainers: fix typo in author name * v9.1.0716: resetting setcellwidth( doesn't update the screen runtime(hcl,terraform): Add runtime files for HCL and Terraform runtime(tmux): Update syntax script * v9.1.0715: Not correctly parsing color names (after v9.1.0709) * v9.1.0714: GuiEnter_Turkish test may fail * v9.1.0713: Newline causes E749 in Ex mode * v9.1.0712: missing dependency of Test_gettext_makefile * v9.1.0711: test_xxd may file when using different xxd * v9.1.0710: popup window may hide part of Command line runtime(vim): Update syntax, improve user-command matching * v9.1.0709: GUIEnter event not found in Turkish locale runtime(sudoers): improve recognized Runas_Spec and Tag_Spec items * v9.1.0708: Recursive window update does not account for reset skipcol runtime(nu): include filetype plugin * v9.1.0707: invalid cursor position may cause a crash * v9.1.0706: test_gettext fails when using shadow dir CI: Install locales-all package * v9.1.0705: Sorting of fuzzy filename completion is not stable translation(pt): update Portuguese/Brazilian menu translation runtime(vim): Update base-syntax, match bracket mark ranges runtime(doc): Update :help :command-complete list * v9.1.0704: inserting with a count is inefficient runtime(doc): use mkdir -p to save a command * v9.1.0703: crash with 2byte encoding and glob2regpat() runtime(hollywood): update syn highlight for If-Then statements and For-In-Loops * v9.1.0702: Patch 9.1.0700 broke CI * v9.1.0701: crash with NFA regex engine when searching for composing chars * v9.1.0700: crash with 2byte encoding and glob2regpat() * v9.1.0699: "dvgo" is not always an inclusive motion runtime(java): Provide support for syntax preview features * v9.1.0698: "Untitled" file not removed when running Test_crash1_3 alone * v9.1.0697: heap-buffer-overflow in ins_typebuf * v9.1.0696: installing runtime files fails when using SHADOWDIR runtime(doc): fix typo * v9.1.0695: test_crash leaves Untitled file around translation(br): Update Brazilian translation translation(pt): Update menu_pt_br * v9.1.0694: matchparen is slow on a long line * v9.1.0693: Configure doesn't show result when not using python3 stable abi * v9.1.0692: Wrong patlen value in ex_substitute() * v9.1.0691: stable-abi may cause segfault on Python 3.11 runtime(vim): Update base-syntax, match :loadkeymap after colon and bar runtime(mane): Improve ManBS mapping * v9.1.0690: cannot set special highlight kind in popupmenu translation(pt): Revert and fix wrong Portuguese menu translation files translation(pt): revert Portuguese menu translation translation(br): Update Brazilian translations runtime(vim): Update base-syntax, improve :let-heredoc highlighting * v9.1.0689: buffer-overflow in do_search( with 'rightleft' runtime(vim): Improve heredoc handling for all embedded scripts * v9.1.0688: dereferences NULL pointer in check_type_is_value() * v9.1.0687: Makefile may not install desktop files runtime(man): Fix ManBS runtime(java): Make the bundled &foldtext function optional runtime(netrw): Change line on `mx` if command output exists runtime(netrw): Fix `mf`-selected entry highlighting runtime(htmlangular): add html syntax highlighting translation(it): Fix filemode of Italian manpages runtime(doc): Update outdated man.vim plugin information runtime(zip): simplify condition to detect MS-Windows * v9.1.0686: zip-plugin has problems with special characters runtime(pandoc): escape quotes in &errorformat for pandoc translation(it): updated Italian manpage * v9.1.0685: too many strlen( calls in usercmd.c runtime(doc): fix grammar in :h :keeppatterns runtime(pandoc): refine pandoc compiler settings * v9.1.0684: completion is inserted on Enter with "noselect" translation(ru): update man pages * v9.1.0683: mode( returns wrong value with mapping runtime(doc): remove trailing whitespace in cmdline.txt * v9.1.0682: Segfault with uninitialized funcref * v9.1.0681: Analyzing failed screendumps is hard runtime(doc): more clarification for the :keeppatterns needed * v9.1.0680: VMS does not have defined uintptr_t runtime(doc): improve typedchar documentation for KeyInputPre autocmd runtime(dist): verify that executable is in $PATH translation(it): update Italian manpages runtime(doc): clarify the effect of :keeppatterns after * v9.1.0677 runtime(doc): update Makefile and make it portable between GNU and BSD * v9.1.0679: Rename from w_closing to w_locked is incomplete runtime(colors): update colorschemes runtime(vim): Update base-syntax, improve :let-heredoc highlighting runtime(doc): Updating the examples in the xxd manpage translation(ru): Updated uganda.rux runtime(yaml): do not re-indent when commenting out lines * v9.1.0678: use-after-free in alist_add() * v9.1.0677 :keepp does not retain the substitute pattern translation(ja): Update Japanese translations to latest release runtime(netrw): Drop committed trace lines runtime(netrw): Error popup not always used runtime(netrw): ErrorMsg( may throw E121 runtime(tutor): update Makefile and make it portable between GNU and BSD translation: improve the po/cleanup.vim script runtime(lang): update Makefile and make it portable between GNU and BSD * v9.1.0676: style issues with man pages * v9.1.0675: Patch v9.1.0674 causes problems runtime(dosbatch): Show %%i as an argument in syntax file runtime(dosbatch): Add syn-sync to syntax file runtime(sql, mysql): fix E169: Command too recursive with sql_type_default = "mysql" * v9.1.0674: compiling abstract method fails because of missing return runtime(javascript): fix a few issues with syntax higlighting runtime(mediawiki): fix typo in doc, test for b:did_ftplugin var runtime(termdebug): Fix wrong test for balloon feature runtime(doc): Remove mentioning of the voting feature runtime(doc): add help tags for json + markdown global variables * v9.1.0673: too recursive func calls when calling super-class method runtime(syntax-tests): Facilitate the viewing of rendered screendumps runtime(doc): fix a few style issues * v9.1.0672: marker folds may get corrupted on undo * v9.1.0671 Problem: crash with WinNewPre autocommand * v9.1.0670: po file encoding fails on *BSD during make translation(it): Update Italian translation translation: Stop using msgconv * v9.1.0669: stable python ABI not used by default Update .gitignore and .hgignore files * v9.1.0668: build-error with python3.12 and stable ABI translations: Update generated po files * v9.1.0667: Some other options reset curswant unnecessarily when set * v9.1.0666: assert_equal( doesn't show multibyte string correctly runtime(doc): clarify directory of Vim's executable vs CWD * v9.1.0665 :for loop runtime(proto): Add indent script for protobuf filetype * v9.1.0664: console vim did not switch back to main screen on exit runtime(zip): zip plugin does not work with Vim 9.0 * v9.1.0663: zip test still resets 'shellslash' option runtime(zip): use defer to restore old settings runtime(zip): add a generic Message function runtime(zip): increment base version of zip plugin runtime(zip): raise minimum Vim version to * v9.0 runtime(zip): refactor save and restore of options runtime(zip): remove test for fnameescape runtime(zip): use :echomsg instead of :echo runtime(zip): clean up and remove comments * v9.1.0662: filecopy( may return wrong value when readlink( fails * v9.1.0661: the zip plugin is not tested. runtime(zip): Fix for FreeBSD's unzip command runtime(doc): capitalize correctly * v9.1.0660: Shift-Insert does work on old conhost translation(it): update Italian manpage runtime(lua): add/subtract a 'shiftwidth' after '('/')' in indentexpr runtime(zip): escape '[' on Unix as well * v9.1.0659: MSVC Makefile is a bit hard to read runtime(doc): fix typo in syntax.txt runtime(doc): -x is only available when compiled with crypt feature * v9.1.0658: Coverity warns about dereferencing NULL pointer. runtime(colors): update Todo highlight in habamax colorscheme * v9.1.0657: MSVC build time can be optimized * v9.1.0656: MSVC Makefile CPU handling can be improved * v9.1.0655: goaccess config file not recognized CI: update clang compiler to version 20 runtime(netrw): honor `g:netrw_alt{o,v}` for `:{S,H,V}explore` * v9.1.0654: completion does not respect completeslash with fuzzy * v9.1.0653: Patch v9.1.0648 not completely right * v9.1.0652: too many strlen( calls in syntax.c * v9.1.0651 :append * v9.1.0650: Coverity warning in cstrncmp() * v9.1.0649: Wrong comment for "len" argument of call_simple_func() * v9.1.0648: [security] double-free in dialog_changed() * v9.1.0647: [security] use-after-free in tagstack_clear_entry runtime(doc): re-format tag example lines, mention ctags --list-kinds * v9.1.0646: imported function may not be found runtime(java): Document "g:java_space_errors" and "g:java_comment_strings" runtime(java): Cluster optional group definitions and their group links runtime(java): Tidy up the syntax file runtime(java): Tidy up the documentation for "ft-java-syntax" runtime(colors): update habamax scheme - tweak diff/search/todo colors runtime(nohlsearch): add missing loaded_hlsearch guard runtime(kivy): Updated maintainer info for syntax script Maintainers: Add maintainer for ondir ftplugin + syntax files runtime(netrw): removing trailing slash when copying files in same directory * v9.1.0645: wrong match when searching multi-byte char case-insensitive runtime(html): update syntax script to sync by 250 minlines by default * v9.1.0644: Unnecessary STRLEN( when applying mapping runtime(zip): Opening a remote zipfile don't work runtime(cuda): source c and cpp ftplugins * v9.1.0643: cursor may end up on invalid position * v9.1.0642: Check that mapping rhs starts with lhs fails if not simplified * v9.1.0641: OLE enabled in console version runtime(thrift): add ftplugin, indent and syntax scripts * v9.1.0640: Makefile can be improved * v9.1.0639: channel timeout may wrap around * v9.1.0638: E1510 may happen when formatting a message for smsg() * v9.1.0637: Style issues in MSVC Makefile - Update apparmor.vim to latest version (from AppArmor 4.0.2) - add support for "all" and "userns" rules, and new profile flags - Update to 9.1.0636: * 9.1.0636: filetype: ziggy files are not recognized * 9.1.0635: filetype: SuperHTML template files not recognized * 9.1.0634: Ctrl-P not working by default * 9.1.0633: Compilation warnings with `-Wunused-parameter` * 9.1.0632: MS-Windows: Compiler Warnings Add support for Files-Included in syntax script tweak documentation style a bit * 9.1.0631: wrong completion list displayed with non-existing dir + fuzzy completion * 9.1.0630: MS-Windows: build fails with VIMDLL and mzscheme * 9.1.0629: Rename of pum hl_group is incomplete * 9.1.0628: MinGW: coverage files are not cleaned up * 9.1.0627: MinGW: build-error when COVERAGE is enabled * 9.1.0626: Vim9: need more tests with null objects include initial filetype plugin * 9.1.0625: tests: test output all translated messages for all translations * 9.1.0624: ex command modifiers not found * 9.1.0623: Mingw: errors when trying to delete non-existing files * 9.1.0622: MS-Windows: mingw-build can be optimized * 9.1.0621: MS-Windows: startup code can be improved * 9.1.0620: Vim9: segfauls with null objects * 9.1.0619: tests: test_popup fails * 9.1.0618: cannot mark deprecated attributes in completion menu * 9.1.0617: Cursor moves beyond first line of folded end of buffer * 9.1.0616: filetype: Make syntax highlighting off for MS Makefiles * 9.1.0615: Unnecessary STRLEN() in make_percent_swname() Add single-line comment syntax Add syntax test for comments Update maintainer info * 9.1.0614: tests: screendump tests fail due to recent syntax changes * 9.1.0613: tests: termdebug test may fail and leave file around Update base-syntax, improve :set highlighting Optionally highlight the :: token for method references * 9.1.0612: filetype: deno.lock file not recognized Use delete() for deleting directory escape filename before trying to delete it * 9.1.0611: ambiguous mappings not correctly resolved with modifyOtherKeys correctly extract file from zip browser * 9.1.0610: filetype: OpenGL Shading Language files are not detected Fix endless recursion in netrw#Explore() * 9.1.0609: outdated comments in Makefile update syntax script Fix flow mapping key detection Remove orphaned YAML syntax dump files * 9.1.0608: Coverity warns about a few potential issues Update syntax script and remove syn sync * 9.1.0607: termdebug: uses inconsistent style * 9.1.0606: tests: generated files may cause failure in test_codestyle * 9.1.0605: internal error with fuzzy completion * 9.1.0604: popup_filter during Press Enter prompt seems to hang translation: Update Serbian messages translation * 9.1.0603: filetype: use correct extension for Dracula * 9.1.0602: filetype: Prolog detection can be improved fix more inconsistencies in assert function docs * 9.1.0601: Wrong cursor position with 'breakindent' when wide char doesn't fit Update base-syntax, improve :map highlighting * 9.1.0600: Unused function and unused error constants * 9.1.0599: Termdebug: still get E1023 when specifying arguments correct wrong comment options fix typo "a xterm" -> "an xterm" * 9.1.0598: fuzzy completion does not work with default completion * 9.1.0597: KeyInputPre cannot get the (unmapped typed) key * 9.1.0596: filetype: devscripts config files are not recognized gdb file/folder check is now performed only in CWD. quote filename arguments using double quotes update syntax to SDC-standard 2.1 minor updates. Cleanup :match and :loadkeymap syntax test files Update base-syntax, match types in Vim9 variable declarations * 9.1.0595: make errors out with the po Makefile * 9.1.0594: Unnecessary redraw when setting 'winfixbuf' using wrong highlight for UTF-8 include simple syntax plugin * 9.1.0593: filetype: Asymptote files are not recognized add recommended indent options to ftplugin add recommended indent options to ftplugin add recommended indent options to ftplugin * 9.1.0592: filetype: Mediawiki files are not recognized * 9.1.0591: filetype: *.wl files are not recognized * 9.1.0590: Vim9: crash when accessing getregionpos() return value 'cpoptions': Include "z" in the documented default * 9.1.0589: vi: d{motion} and cw work differently than expected update included colorschemes grammar fixes in options.txt - Add "Keywords" to gvim.desktop to make searching for gvim easier - Removed patches, as they're no longer required (refreshing them deleted their contents): * vim-7.3-help_tags.patch * vim-7.4-highlight_fstab.patch - Reorganise all applied patches in the spec file. - Update to 9.1.0588: * 9.1.0588: The maze program no longer compiles on newer clang runtime(typst): Add typst runtime files * 9.1.0587: tests: Test_gui_lowlevel_keyevent is still flaky * 9.1.0586: ocaml runtime files are outdated runtime(termdebug): fix a few issues * 9.1.0585: tests: test_cpoptions leaves swapfiles around * 9.1.0584: Warning about redeclaring f_id() non-static runtime(doc): Add hint how to load termdebug from vimrc runtime(doc): document global insert behavior * 9.1.0583: filetype: *.pdf_tex files are not recognized * 9.1.0582: Printed line doesn't overwrite colon when pressing Enter in Ex mode * 9.1.0581: Various lines are indented inconsistently * 9.1.0580: :lmap mapping for keypad key not applied when typed in Select mode * 9.1.0579: Ex command is still executed after giving E1247 * 9.1.0578: no tests for :Tohtml * 9.1.0577: Unnecessary checks for v:sizeoflong in test_put.vim * 9.1.0576: tests: still an issue with test_gettext_make * 9.1.0575: Wrong comments in alt_tabpage() * 9.1.0574: ex: wrong handling of commands after bar runtime(doc): add a note for netrw bug reports * 9.1.0573: ex: no implicit print for single addresses runtime(vim): make &indentexpr available from the outside * 9.1.0572: cannot specify tab page closing behaviour runtime(doc): remove obsolete Ex insert behavior * 9.1.0571: tests: Test_gui_lowlevel_keyevent is flaky runtime(logindefs): update syntax with new keywords * 9.1.0570: tests: test_gettext_make can be improved runtime(filetype): Fix Prolog file detection regex * 9.1.0569: fnamemodify() treats ".." and "../" differently runtime(mojo): include mojo ftplugin and indent script * 9.1.0568: Cannot expand paths from 'cdpath' setting * 9.1.0567: Cannot use relative paths as findfile() stop directories * 9.1.0566: Stop dir in findfile() doesn't work properly w/o trailing slash * 9.1.0565: Stop directory doesn't work properly in 'tags' * 9.1.0564: id() can be faster * 9.1.0563: Cannot process any Key event * 9.1.0562: tests: inconsistency in test_findfile.vim runtime(fstab): Add missing keywords to fstab syntax * 9.1.0561: netbeans: variable used un-initialized (Coverity) * 9.1.0560: bindtextdomain() does not indicate an error * 9.1.0559: translation of vim scripts can be improved * 9.1.0558: filetype: prolog detection can be improved * 9.1.0557: moving in the buffer list doesn't work as documented runtime(doc): fix inconsistencies in :h file-searching * 9.1.0556: :bwipe doesn't remove file from jumplist of other tabpages runtime(htmlangular): correct comment * 9.1.0555: filetype: angular ft detection is still problematic * 9.1.0554: :bw leaves jumplist and tagstack data around * 9.1.0553: filetype: *.mcmeta files are not recognized * 9.1.0552: No test for antlr4 filetype * 9.1.0551: filetype: htmlangular files are not properly detected * 9.1.0550: filetype: antlr4 files are not recognized * 9.1.0549: fuzzycollect regex based completion not working as expected runtime(doc): autocmd_add() accepts a list not a dict * 9.1.0548: it's not possible to get a unique id for some vars runtime(tmux): Update syntax script * 9.1.0547: No way to get the arity of a Vim function * 9.1.0546: vim-tiny fails on CTRL-X/CTRL-A runtime(hlsplaylist): include hlsplaylist ftplugin file runtime(doc): fix typo in :h ft-csv-syntax runtime(doc): Correct shell command to get $VIMRUNTIME into shell * 9.1.0545: MSVC conversion warning * 9.1.0544: filetype: ldapconf files are not recognized runtime(cmakecache): include cmakecache ftplugin file runtime(lex): include lex ftplugin file runtime(yacc): include yacc ftplugin file runtime(squirrel): include squirrel ftplugin file runtime(objcpp): include objcpp ftplugin file runtime(tf): include tf ftplugin file runtime(mysql): include mysql ftplugin file runtime(javacc): include javacc ftplugin file runtime(cabal): include cabal ftplugin file runtime(cuda): include CUDA ftplugin file runtime(editorconfig): include editorconfig ftplugin file runtime(kivy): update kivy syntax, include ftplugin runtime(syntax-tests): Stop generating redundant "*_* 99.dump" files * 9.1.0543: Behavior of CursorMovedC is strange runtime(vim): Update base-syntax, improve :match command highlighting * 9.1.0542: Vim9: confusing string() output for object functions * 9.1.0541: failing test with Vim configured without channel * 9.1.0540: Unused assignment in sign_define_cmd() runtime(doc): add page-scrolling keys to index.txt runtime(doc): add reference to xterm-focus-event from FocusGained/Lost * 9.1.0539: Not enough tests for what v9.1.0535 fixed runtime(doc): clarify how to re-init csv syntax file * 9.1.0538: not possible to assign priority when defining a sign * 9.1.0537: signed number detection for CTRL-X/A can be improved * 9.1.0536: filetype: zone files are not recognized * 9.1.0535: newline escape wrong in ex mode runtime(man): honor cmd modifiers before `g:ft_man_open_mode` runtime(man): use `nnoremap` to map to Ex commands * 9.1.0534: completion wrong with fuzzy when cycling back to original runtime(syntax-tests): Abort and report failed cursor progress runtime(syntax-tests): Introduce self tests for screen dumping runtime(syntax-tests): Clear and redraw the ruler line with the shell info runtime(syntax-tests): Allow for folded and wrapped lines in syntax test files * 9.1.0533: Vim9: need more tests for nested objects equality CI: Pre-v* 9.0.0110 versions generate bogus documentation tag entries runtime(doc): Remove wrong help tag CTRL-SHIFT-CR * 9.1.0532: filetype: Cedar files not recognized runtime(doc): document further keys that scroll page up/down * 9.1.0531: resource leak in mch_get_random() runtime(tutor): Fix wrong spanish translation runtime(netrw): fix remaining case of register clobber * 9.1.0530: xxd: MSVC warning about non-ASCII character * 9.1.0529: silent! causes following try/catch to not work runtime(rust): use shiftwidth() in indent script * 9.1.0528: spell completion message still wrong in translations * 9.1.0527: inconsistent parameter in Makefiles for Vim executable * 9.1.0526: Unwanted cursor movement with pagescroll at start of buffer runtime(doc): mention $XDG_CONFIG_HOME instead of $HOME/.config * 9.1.0525: Right release selects immediately when pum is truncated. * 9.1.0524: the recursive parameter in the *_equal functions can be removed runtime(termdebug): Add Deprecation warnings * 9.1.0523: Vim9: cannot downcast an object * 9.1.0522: Vim9: string(object) hangs for recursive references * 9.1.0521: if_py: _PyObject_CallFunction_SizeT is dropped in Python 3.13 * 9.1.0520: Vim9: incorrect type checking for modifying lists runtime(manpager): avoid readonly prompt * 9.1.0519: MS-Windows: libvterm compilation can be optimized * 9.1.0518: initialize the random buffer can be improved * 9.1.0517: MS-Windows: too long lines in Make_mvc.mak runtime(terraform): Add filetype plugin for terraform runtime(dockerfile): enable spellchecking of comments in syntax script runtime(doc): rename variable for pandoc markdown support runtime(doc): In builtin overview use {buf} as param for appendbufline/setbufline runtime(doc): clarify, that register 1-* 9 will always be shifted runtime(netrw): save and restore register 0-* 9, a and unnamed runtime(termdebug): Refactored StartDebug_term and EndDebug functions runtime(java): Compose "g:java_highlight_signature" and "g:java_highlight_functions" * 9.1.0516: need more tests for nested dicts and list comparision * 9.1.0515: Vim9: segfault in object_equal() * 9.1.0514: Vim9: issue with comparing objects recursively runtime(termdebug): Change some variables to Enums runtime(vim): Update base-syntax, fix function tail comments * 9.1.0513: Vim9: segfault with object comparison - Update to 9.1.0512: * Mode message for spell completion doesn't match allowed keys * CursorMovedC triggered wrongly with setcmdpos() * update runtime files * CI: test_gettext fails on MacOS14 + MSVC Win * not possible to translate Vim script messages * termdebug plugin can be further improved * add gomod filetype plugin * hard to detect cursor movement in the command line * Optionally highlight parameterised types * filetype: .envrc & .prettierignore not recognized * filetype: Faust files are not recognized * inner-tag textobject confused about ">" in attributes * cannot use fuzzy keyword completion * Remove the group exclusion list from @javaTop * wrong return type for execute() function * MS-Windows: too much legacy code * too complicated mapping restore in termdebug * simplify mapping * cannot switch buffer in a popup * MS-Windows: doesn't handle symlinks properly * getcmdcompltype() interferes with cmdline completion * termdebug can be further improved * update htmldjango detection * Improve Turkish documentation * include a simple csv filetype and syntax plugin * include the the simple nohlsearch package * matched text is highlighted case-sensitively * Matched text isn't highlighted in cmdline pum * Fix typos in several documents * clarify when text properties are cleared * improve the vim-shebang example * revert unintended formatting changes for termdebug * Add a config variable for commonly used compiler options * Wrong matched text highlighted in pum with 'rightleft' * bump length of character references in syntax script * properly check mapping variables using null_dict * fix KdlIndent and kdlComment in indent script * Test for patch 9.1.0489 doesn't fail without the fix * Fold multi-line comments with the syntax kind of &fdm * using wrong type for PlaceSign() * filetype: Vim-script files not detected by shebang line * revert unintended change to zip#Write() * add another tag for vim-shebang feature * Cmdline pum doesn't work properly with 'rightleft' * minor style problems with patch 9.1.0487 * default completion may break with fuzzy * Wrong padding for pum "kind" with 'rightleft' * Update base-syntax, match shebang lines * MS-Windows: handle files with spaces properly * Restore HTML syntax file tests * completed item not update on fuzzy completion * filetype: Snakemake files are not recognized * make TermDebugSendCommand() a global function again * close all buffers in the same way * Matched text shouldn't be highlighted in "kind" and "menu" * fix wrong helptag for :defer * Update base-syntax, match :sleep arg * include Georgian keymap * Sorting of completeopt+=fuzzy is not stable * correctly test for windows in NetrwGlob() * glob() on windows fails with [] in directory name * rewrite mkdir() doc and simplify {flags} meaning * glob() not sufficiently tested * update return type for job_info() * termdebug plugin needs more love * correct return types for job_start() and job_status() * Update base-syntax, match :catch and :throw args * Include element values in non-marker annotations * Vim9: term_getjob() throws an exception on error * fuzzy string matching executed when not needed * fuzzy_match_str_with_pos() does unnecessary list operations * restore description of "$" in col() and virtcol() * deduplicate getpos(), line(), col(), virtcol() * Update g:vimsyn_comment_strings dump file tests * Use string interpolation instead of string concat * potential deref of NULL pointer in fuzzy_match_str_with_pos * block_editing errors out when using * Update base-syntax, configurable comment string highlighting * fix typos in syntax.txt * Cannot see matched text in popup menu * Update base-syntax, match multiline continued comments * clarify documentation for "v" position at line() * cmod_split modifier is always reset in term_start() * remove line-continuation characters * use shiftwidth() instead of &tabstop in indent script * Remove orphaned screen dump files * include syntax, indent and ftplugin files * CI: Test_ColonEight() fails on github runners * add missing Enabled field in syntax script * basic svelte ftplugin file * term_start() does not clear vertical modifier * fix mousemodel restoration by comparing against null_string * Added definitions of Vim scripts and plugins * Exclude lambda expressions from _when_ _switch-case_ label clauses * Fix saved_mousemodel check * Inconsistencies between functions for option flags * Crash when using autocmd_get() after removing event inside autocmd * Fix small style issues * add return type info for Vim function descriptions * Update Italian Vim manpage * disable the q mapping * Change 'cms' for C++ to '// %s' * fix type mismatch error * Fix wrong email address * convert termdebug plugin to Vim9 script - Update to 9.1.0470: * tests Test_ColonEight_MultiByte() fails sporadically * Cannot have buffer-local value for 'completeopt' * GvimExt does not consult HKEY_CURRENT_USER * typos in some comments * runtime(vim): Update base-syntax, allow whitespace before :substitute pattern * Missing comments for fuzzy completion * runtime(man): update Vim manpage * runtime(comment): clarify the usage of 'commentstring' option value * runtime(doc): clarify how fuzzy 'completeopt' should work * runtime(netrw): prevent accidental data loss * missing filecopy() function * no whitespace padding in commentstring option in ftplugins * no fuzzy-matching support for insert-completion * eval5() and eval7 are too complex * too many strlen() calls in drawline.c * filetype lintstagedrc files are not recognized * Vim9 import autoload does not work with symlink * Coverity complains about division by zero * tests test_gui fails on Wayland * Left shift is incorrect with vartabstop and shiftwidth=0 * runtime(doc): clarify 'shortmess' flag "S" * MS-Windows compiler warning for size_t to int conversion * runtime(doc): include some vim9 script examples in the help * minor issues in test_filetype with rasi test * filetype rasi files are not recognized * runtime(java): Improve the matching of lambda expressions * Configure checks for libelf unnecessarily * No test for escaping '<' with shellescape() * check.vim complains about overlong comment lines * translation(it): Update Italian translation * evalc. code too complex * MS-Windows Compiler warnings - Update to 9.1.0448: * compiler warning in eval.c * remove remaining css code * Add ft_hare.txt to Reference Manual TOC * re-generate vim syntax from generator * fix syntax vim bug * completion may be wrong when deleting all chars * getregionpos() inconsistent for partly-selected multibyte char * fix highlighting nested and escaped quotes in string props * remove the indent plugin since it has too many issues * update Debian runtime files * Coverity warning after 9.1.0440 * Not enough tests for getregion() with multibyte chars * Can't use blockwise selection with width for getregion() * update outdated syntax files * fix floating_modifier highlight * hare runtime files outdated * getregionpos() can't properly indicate positions beyond eol * function get_lval() is too long * Cannot filter the history * Wrong Ex command executed when :g uses '?' as delimiter * support floating_modifier none; revert broken highlighting * Motif requires non-const char pointer for XPM data * Crash when using '?' as separator for :s * filetype: cygport files are not recognized * make errors trying to access autoload/zig * Wrong yanking with exclusive selection and ve=all * add missing help tags file * Ancient XPM preprocessor hack may cause build errors * include basic rescript ftplugin file * eval.c is too long * getregionpos() doesn't handle one char selection * check for gdb file/dir before using as buffer name * refactor zig ftplugin, remove auto format * Coverity complains about eval.c refactor * Tag guessing leaves wrong search history with very short names * some issues with termdebug mapping test * update matchit plugin to v1.20 * too many strlen() calls in search.c * set commentstring option * update vb indent plugin as vim9script * filetype: purescript files are not recognized * filetype: slint files are not recognized * basic nim ftplugin file for comments * Add Arduino ftplugin and indent files * include basic typst ftplugin file * include basic prisma ftplugin file * include basic v ftplugin for comment support * getregionpos() wrong with blockwise mode and multibyte * function echo_string_core() is too long * hyprlang files are not recognized * add basic dart ftplugin file * basic ftplugin file for graphql * mention comment plugin at :h 'commentstring' * set commentstring for sql files in ftplugin * :browse oldfiles prompts even with single entry * eval.c not sufficiently tested * clarify why E195 is returned * clarify temporary file clean up * fix :NoMatchParen not working * Cannot move to previous/next rare word * add basic ftplugin file for sshdconfig * if_py: find_module has been removed in Python 3.12.0a7 * some screen dump tests can be improved * Some functions are not tested * clarify instal instructions for comment package * Unable to leave long line with 'smoothscroll' and 'scrolloff' * fix typo in vim9script help file * Remove trailing spaces * clarify {special} argument for shellescape() - update to 9.1.0413 * smoothscroll may cause infinite loop * add missing entries for the keys CTRL-W g and * update vi_diff.txt: add default value for 'flash' * typo in regexp_bt.c in DEBUG code * allow indented commands * Fix wrong define regex in ftplugin * Filter out non-Latin-1 characters for syntax tests * prefer scp over pscp * fix typo in usr_52.txt * too long functions in eval.c * warning about uninitialized variable * too many strlen() calls in the regexp engine * E16 fix, async keyword support for define * Stuck with long line and half-page scrolling * Divide by zero with getmousepos() and 'smoothscroll' * update and remove some invalid links * update translation of xxd manpage * Recursively delete directories by default with netrw delete command * Strive to remain compatible for at least Vim 7.0 * tests: xxd buffer overflow fails on 32-bit * Stop handpicking syntax groups for @javaTop * [security] xxd: buffer-overflow with specific flags * Vim9: not able to import file from start dir * filetype: mdd files detected as zsh filetype * filetype: zsh module files are not recognized * Remove hardcoded private.ppk logic from netrw * Vim9: confusing error message for unknown type * block_editing errors out when using del * add new items to scripts section in syntax plugin * Vim9: imported vars are not properly type checked * Wrong display with 'smoothscroll' when changing quickfix list * filetype: jj files are not recognized * getregionpos() may leak memory on error * The CODEOWNERS File is not useful * Remove and cleanup Win9x legacy from netrw * add MsgArea to 'highlight' option description * Cannot get a list of positions describing a region * Fix digit separator in syntax script for octals and floats * Update link to Wikipedia Vi page * clear $MANPAGER in ftplugin before shelling out * Fix typos in help documents * 'viewdir' not respecting $XDG_CONFIG_HOME * tests: Vim9 debug tests may be flaky * correct getscriptinfo() example * Vim9: could improve testing * test_sound fails on macos-12 * update Serbian menu * update Slovak menu * update Slovenian menu * update Portuguese menu * update Dutch menu * update Korean menu * update Icelandic menu * update Czech menu * update Afrikaans menu * update German menu * filetype: inko files are not recognized * filetype: templ files are not recognized * cursor() and getregion() don't handle v:maxcol well * Vim9: null value tests not sufficient * update Catalan menu * filetype: stylus files not recognized * update spanish menu localization * regenerate helptags * Vim9: crash with null_class and null_object * Add tags about lazyloading of menu * tests: vt420 terminfo entry may not be found * filetype: .out files recognized as tex files * filetype: Kbuild files are not recognized * cbuffer and similar commands don't accept a range * Improve the recognition of the "indent" method declarations * Fix a typo in usr_30.txt * remove undefined var s:save_cpoptions and add include setting * missing setlocal in indent plugin * Calculating line height for unnecessary amount of lines * improve syntax file performance * There are a few typos * Vim9: no comments allowed after class vars * CI: remove trailing white space in documentation * Formatting text wrong when 'breakindent' is set * Add oracular (24.10) as Ubuntu release name * Vim9: Trailing commands after class/enum keywords ignored * tests: 1-second delay after Test_BufEnter_botline() * update helptags for jq syntax * include syntax, ftplugin and compiler plugin * fix typo synconcealend -> synconcealed * include a simple comment toggling plugin * wrong botline in BufEnter * clarify syntax vs matching mechanism * fix undefined variable in indent plugin * ops.c code uses too many strlen() calls * Calling CLEAR_FIELD() on the same struct twice * Vim9: compile_def_function() still too long * Update Serbian messages * clarify the effect of setting the shell to powershell * Improve the recognition of the "style" method declarations * Vim9: problem when importing autoloaded scripts * compile_def_function is too long * filetype: ondir files are not recognized * Crash when typing many keys with D- modifier * tests: test_vim9_builtin is a bit slow * update documentation * change the download URL of "libsodium" * tests: test_winfixbuf is a bit slow * Add filetype, syntax and indent plugin for Astro * expanding rc config files does not work well * Vim9: vim9type.c is too complicated * Vim9: does not handle autoloaded variables well * minor spell fix in starting.txt * wrong drawing in GUI with setcellwidth() * Add include and suffixesadd * Page scrolling should place cursor at window boundaries * align command line table * minor fixes to starting.txt * fix comment definition in filetype plugin * filetype: flake.lock files are not recognized * runtime(uci): No support for uci file types * Support "g:ftplugin_java_source_path" with archived files * tests: Test_autoload_import_relative_compiled fails on Windows * Finding cmd modifiers and cmdline-specials is inefficient * No test that completing a partial mapping clears 'showcmd' * tests: test_vim9_dissamble may fail * Vim9: need static type for typealias * X11 does not ignore smooth scroll event * A few typos in test_xdg when testing gvimrc * Patch v9.1.0338 fixed sourcing a script with import * Problem: gvimrc not sourced from XDG_CONFIG_HOME * Cursor wrong after using setcellwidth() in terminal * 'showcmd' wrong for partial mapping with multibyte * tests: test_taglist fails when 'helplang' contains non-english * Problem: a few memory leaks are found * Problem: Error with matchaddpos() and empty list * tests: xdg test uses screen dumps * Vim9: import through symlinks not correctly handled * Missing entry for XDG vimrc file in :version * tests: typo in test_xdg * runtime(i3config/swayconfig): update syntax scripts * document pandoc compiler and enable configuring arguments * String interpolation fails for List type * No test for highlight behavior with 'ambiwidth' * tests: test_xdg fails on the appimage repo * tests: some assert_equal() calls have wrong order of args * make install does not install all files * runtime(doc): fix typos in starting.txt- Updated to version 9.1 with patch level 0330, fixes the following problems * Fixing bsc#1220763 - vim gets Segmentation fault after updating to version 9.1.0111-150500.20.9.1 - refreshed vim-7.3-filetype_spec.patch - refreshed vim-7.3-filetype_ftl.patch - Update spec.skeleton to use autosetup in place of setup macro. - for the complete list of changes see https://github.com/vim/vim/compare/v9.1.0111...v9.1.0330- Updated to version 9.1 with patch level 0111, fixes the following security problems * Fixing bsc#1217316 (CVE-2023-48231) - VUL-0: CVE-2023-48231: vim: Use-After-Free in win_close() * Fixing bsc#1217320 (CVE-2023-48232) - VUL-0: CVE-2023-48232: vim: Floating point Exception in adjust_plines_for_skipcol() * Fixing bsc#1217321 (CVE-2023-48233) - VUL-0: CVE-2023-48233: vim: overflow with count for :s command * Fixing bsc#1217324 (CVE-2023-48234) - VUL-0: CVE-2023-48234: vim: overflow in nv_z_get_count * Fixing bsc#1217326 (CVE-2023-48235) - VUL-0: CVE-2023-48235: vim: overflow in ex address parsing * Fixing bsc#1217329 (CVE-2023-48236) - VUL-0: CVE-2023-48236: vim: overflow in get_number * Fixing bsc#1217330 (CVE-2023-48237) - VUL-0: CVE-2023-48237: vim: overflow in shift_line * Fixing bsc#1217432 (CVE-2023-48706) - VUL-0: CVE-2023-48706: vim: heap-use-after-free in ex_substitute * Fixing bsc#1219581 (CVE-2024-22667) - VUL-0: CVE-2024-22667: vim: stack-based buffer overflow in did_set_langmap function in map.c * Fixing bsc#1215005 (CVE-2023-4750) - VUL-0: CVE-2023-4750: vim: Heap use-after-free in function bt_quickfix - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.2103...v9.1.0111- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.2103- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxdh02-armsrv2 1741702392  9.1.1176-150500.20.24.29.1.1176-150500.20.24.29.1.1176-150500.20.24.29.1.1176-150500.20.24.29.1.1176-150500.20.24.29.1.1176-150500.20.24.29.1.1176-150500.20.24.2 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:37807/SUSE_SLE-15-SP5_Update/2b7065bb7bdbd5fadb002209a8412d00-vim.SUSE_SLE-15-SP5_Updatedrpmxz5aarch64-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.1176-150500.20.24.2.aarch64/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.1176-150500.20.24.2.aarch64/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=fefb2908bae3f7cecb284cbf76583a0f9af2cc8a, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image##RR R$RRRR"R R&RRRRRRRRRRRRRR RRR#R%R R RRR R!RRPPP P PP PPPPPPPPPP P E'j iY;1%_Cutf-85ab353a1683c14ea197c1e18f0f338758c261295d16181508fcef822630a0621?7zXZ !t/W]"k%{J #20n'\#gJx*Qm}] KDӣtBO; /7mi?[o2{=eLϝRpv/qM} Oczz +PUJ-\YSZLWj1ӌg~V5ܬXOpI@6=ĜNn=E٥fZ̕UdYA-ѡ 2Nu^X"giBUk1>Ix 5&b-0吙}%hOУyVTvXuaPgHmȎ mwǢU>%Hf>Fc9-U@~`k߿C +j^՟^J,Ë8*,x.cwDI5`F;*lccеhwt8~nIiADc Ix.=jdGt^Є$FT`WBOu DݘM4\3I^T^1_RDUe`X5 "l!7 Nшqu >"7| ovU+,ک xwry2DmѴ!jmWFyێ 2pcU|܁WR{<y RT3 [ QCҌ6k@C2^sPNrO nMu)5?1 R`x0,۴)LsuKgWLco?;`Жસ9"vDdn<EO]"2~m 6cN.,xAmeu. J 瑎n!0w!0kqDJvmu1ƲeV簭x"Ds\ݘ9و˜^p(H悝rL ղH;5A5;Ve6T=2>֗g]GUE]OmErAJ1J}@[09k/( νv @Wrf^!%~ew1Y;us=^!C$oG`#c<(5WԎ8 G fkŐ7u%0nl1&շkTƃ0p{ %$ ^ʦT7M7&p P ,v^ $ErhpAR-dؠ%d~Z;מT_RQs5ooa a#  p/^ bf:P6~BBV0nBDAۧď=iv>HV@p8 goxdw*g*RݱW>ZK?Gx㔪 \OH)e>{">YmsrD"ێx#B.!i>Wkֳ4?z aKҔDHdE1-Dv]kZ4-DPg(P@77_ǡA/أD>N@ E{MMr4ϴ'g~G9eVBʹ]AAU6yQN/̀=9T}S[+* !bW8d8֫FA,*bGb2zs8EΊRr ;ݜm|%Dqm#jSZR^ѭԒlJǘy|ݢ|| %nI͉yVJKuDt3q4@@|)+a @ErY =" 1+1OD-iY3)x3HmM8v˒C@t1tP 8SYlہ&|ɀ8Weu@jX/z]P"p&]7w(M_hh'Rt5Bg+FJ[CGyws@/*)'j}^guo.XJRxPrH@gXA]\ibh:zDfؼ KB遤N8Ejv/v+ ']əDxiBe#R1EZcs2^o>qP["C*@T`Pj \^V/ 7Έ'm5e<&:8vOYQ!>kmRPr:_^o04/l]zۅCu0།2/%)ҭn9DQ;3?Zԫ5\|nJ0. ݠBliC'b!6/i>,@һ \DMYĠovw.?iȨ!{n.|0.s8ϻ%SiC-ABӦ84Oݵ5r!/\;\̟ E\ Q,ļߒ*akv䆂{pKnO% .EF2rr|;çtVY{B|O `EhHr5u舱0ҏA9E3 3UR4()} b8֊( P}#(`X|*MGFp}YM3#%F9̳\qf;AD@i#l-ftΝl3E G*r~苪jt ʗ]{!:WwX!$-/J4Oun)o^xx,?s΄ZY02_t*g}N IEP2]8l,fx(PZHh8-tiPOlEftWnrx竗yj)yzIlur=T8FO6 g2yLt|֐yƂPc^ȝ\NfZO#Hi#}V dh dÁŇśvnRfd@l׍Fd{LY𦤶GZK Oc){c-tqԙ~c`߽HKk(X_lJ vWj}u۾*rFbd8uqt]R82D{5F)+k+DI9Ep\5*{p]-_b`+2X&YC4Q҉nǛzS2'nU[oyxgi*nDR^׈O߉n$XrQƀ&~!\ͳ1¯ށ xM $ AMYDh^j~ 0*87 XWWc}\mO6jY /S[I HXF?Fuh:Q< AEJ)5{+.ܗӲb pįyzKWUWcdO쵖&Ń!͐-ث@{$/#-Oc{ y2Wu_.<_>dY1}:Ǝ|W8cx|!(^®eg1hռtx&yndQg[|+l4[eQPJ p]M#`JpUKb nf*E61kFa0*lT_`Wwz5/[f@cyъvt9X5YY^HEIs@7Q,A|v&/ ܜ. aD68|z$јjң[>Uo˩  A9g&REbsxcq'gV""0 P\|㠀Ts)26*|s+wg?@F6Uax}I덤Ct2i] ' n:Cs@6ۘ܏MW /m0-%'86=T\; d8c~d=/CEuKy&Z %CCiThh*gOuܶoKSv;iVߌ|}D'@d>uJ2EO@ JK#W;p!ԹQF$6@X"' wpr@tsd $) !}n#Wj(C.,=G4/|QNMonuaSgȏ96iM0o;[iOg p3uj;8fLH;Ux$G#ԗbJ]v&!rQ)1г 8aܛ(Q`WoL2.4Ε7l3DPXr)ؕu6NTX֪-p+܌YEʷJ\j-scpD&OX0Q4d9aJʲ^BI%{SvS OQrJ>Lʈ m u~n;Xt\'nA[Wᡰ>-Vv

;,T >`BD ˆbC/y#G846“rR JtW91Q ɃF1&mZWLwQ8;.a (]-/axevT*ds:\#H&Ww< ]BdpgkՇY%Eߖc H_ل!rWb).|6 2p =AӖN,+j(e<_&~{foWzCąC$0+k\lfd}o2Ig}iN\% F=q ֓?C?\v핚2ߏ-!w#9mʋO(DIqGMu{&2aݣdiKU*&¹yzsrju?";e6C;uz!Кb<;^mXvȑeaS~RN|c`D}Q=zt?Y\HtA(Ais}jnElU vOxf@QCfq:ڧ#lr:z^཮KJ}'39Zns;wuR{O8Eɚjes= T\wcH?#XJXJZBѭݝTn-۴<|*"BRlɞ #nȒ'8BvrBiZڬtItgkOWyA.G\]nU_1ג’8Ɂ-c)!J:|bFPyAyaoW2f}$C r<_ f. s-5}  &G@JL͡ oBru *z4\$(nG/Knή%i_ ,Ґpfs`1gʱR'EX63o@(ٙ↧(bliŬH:s@n"87w`Xȑ4{.Kqsnßvˆh4d\7?ݜ+@[, ppT EyL͎P3l6Ny2j=FK4 Fq"8ݔ #g@ag LV+#zܑám:%M*[^UdiKF7Fҝ!CmZڐEiA] 93a8Ti]1WWUYiђkC`_.3+ &:E4j]۾9;u;!VdcFD/S:.o[1 q驛SL;iBy&K9zv:XMvo}KDQ :g2bOL19G1㪪O nI :Q0yurW:Iú<07…ctE* P?Z*i8*Cfxh`vl֘'"yq͡)N,RfKfvuQڸ 6P\$~loe0xrz02-2ȷ䴶k/ݑbKlR&f-3:Y`(sM}U~ÝƬeӈg:NTl}6-JAG!~u `O R[E[ C15W~jA229 bZS?bGҜɏriK>הj((E#o#rK8w\~jT 걫b7fѾ5Īy[gx#0c&F?2RyҡjqøPG+;i ａŗe1oThԈ.HeJdZXKm3zyK.);D/9 F5wh}MLl nNK)c wB]l3xyiImh!7tʡucV.*dGԦxgLn ie \h+I {?uXt.WL`7 Xsu,7),p\ý!kbCHxv*̪0ufB.OV I5zvkw2Qkn၉LOO"pYq#++|1TuSYpe dmg~To.k񟸂Kvg/ sч(8ٰ?VNEDm=Q/9_qT3KGZxAa%KD-ٴ?(L+şC oV;Xs6ٿSOZE It8ÐNwpSsIgM6Ll, e_ŊiHnXdb}w.Y9yS.&^ Ta$h~-1mu?IQJ=@[Bey4?F B),# XxO,18dO.N52r]mZBv/I#/,'si#B n??aSmF=hR+8;7eKA\mES6@HE$̒ BN7 Qq,&٦`1LιwS^̰Л_eӅQ(1Td|0XH'3 i$#3fK[ny1ʇ8ގYTfUdm((^ϸ@_YOۇ~?Q׿.]6F;I=m\:BI6W(OeEuOS,jv4U\ >).u R*&^$F1<0H~:uf Xߜa#oBel+ہVNU Dzā+bBvKQ&u"ѵ"(d>l= / 2-e"ILDX̆ lV.eTfahxYC $L c^í^ڟg(vX&@`rG4ޑ'zlP}tmCq\.#ml|S/ i OFȱ2!r,HtcIo=sYhvҡUf: {,35AJv1 xZak*Х8.Qx}d^b.8qe%s0ٵwq\W^؝!죟FyC5YN~vZB7q:TH#E'Dؠ4^Z~5^ e37*0]qˌ&hs'BFY &FBdT~#q]b h=M 7(,4"lhfoBl'Sc9iR\Ilaȥa8v,A`JN {<wu%C%` oeÓw=M˚TNGgk$fR&2|!VK2v;<>X&↚s~a>٨esTzF?ʷ aC.5 C3m5XH- ?'Abɻ`l:M>m07SEHX;A $6]ʧ`3i@yf{neEIB`ETc`+Dޗ_/q`%_.-H'͞X>3$,RV5ws)`g.,_Pu%WOvTi%t?4DS pWC!Ο7RZ ^[0ԭY3%i99pM3tƼi'\PDž|z I oܘcp sw؆R(h;&bQ' [4VqnQ]=}QQDL_tXZuetB2SN \-/7/~ D?l'=8j*p98xĵ7R8 |!S{'bk30'*U]8"̀RfҏpI4Wdb/˯_~D,aLj<Ʃl?o{M/=܎A@u`M+"8hjM / /]~!PP6nm5|%u['_}!V|+zN(QtWXޥ|[exg)4Ӑ@T ?:U7.Ř ;C`Tː1#683Po~Z|@^([ '?!dvM"Wy@ XĩHi= L~1܋x|k84 qnK|/p;V8{7'"yራttv8@.AsgMId &} }ï=~9DN0G ExiBĎk~b;K’##WtqkmʃQ\ƸDDBwH>{ALaNXu֕Wus@{i$L‰$c)g⺒Yq"&i~O?f: JZ3PNEnH?ZJ9 }|R!qU͡bGCOrO}Ĥr*Μ[s20p--婟zLu+例?q!I  {u!ǰc2|9i7ʊta]m o1 !4I,`W:&5|wܞ>Ú`m=>sJx`7d1bz>]ۿ|Aa4moR;Bdņ<^,Y/(߷ɹ(y[ 7^k6NwA,9\*UmzƿvL&<-" aZܝn Ws[b-xp|2B)V_>3h+_|=@ڷ2'%xw¶#jy-j#O۾qh?fwHfӞ—Qۼ*A36(899љtW->t,0TE"_ףι8*Eqª oWHt$9Qs*Dmc!*B$׍,zpn"iBǸCLv,OG1竀 1lyȹHI -g{xXP)UzVI{IO"4L{Ul 4=\m)ET=8; g5I#.oAA;yExA/N/Wzg 8rTM(tkxk&g?֬!mZyf=JQnzWgv˰YK*f}mز\C ?ӬȾ-KtA6ԯnx66JU0FPZ!0Мh>c-"_q@ʗ$!ΌB湜lZFPT_ʑ,R;`vR6gZqmu#<7g}\sCw۶qHyS  q=WBJ? 8)Ds9x-u=ys[c1,ˣc 'Tob33po[oN:z`mk$f FҐ3hw!<)@ KUjXμ1<FhځQx> \AWGDsj:Ro^M;wBx37PvܢNṮv\xoެ0OҌC 㣖[_uϦNtKYGS!gS  EiC~q]VxpP2}_Es ̭*WMt3 MQE+ImQeMws;p5Eڨ (8Kh"@!_(6x_G# ;b 95)WVKzBXɛ8w(m'o!Bfl~ du2VxLM)#/mЦAjbqO\t۹㷵|FϙYRϠt[,2ͧv3j wD}cP[ďQ>UL}e@L_c9{(̱(ƒkye c2t&Db ;~_&ܳxYgC/9? DQa0s?tuƒuK󵽓v.f^⇺`GhG kK]9KL^`8,[OB.K\F֛7҉dUa~7dC`g`並"O*g/,,d V Np*Ziʷ:@_M9M ]v`L%ӄpks [lQfsI*HBppuEБbS{de%jiX_*-% $|4fdz{2}/c`O aҨbO2W(9z Ygy[ R4'~"G B RfwXܑigtx  O8BbA eH=&BnԴ8sZe+~.M]%Mu*jft*>:nA@Xlq蘉^,<23&IqPM"ҏ1* bffT}N G.i{nvh%6(Z>/WTFdurLy9 0yscνTJ"SI^`i]S( L4K=[e ??1'em4T ?dj6P~j![,RaΨ=>ߴ_+L lο $!\A$rfKhQ7jjrqzyU{TrZw}N.T|)KaqKtUȯ ZբtX}G1`Moֹ d 7D\j 䚊 M֟g77]{k&FkID>40á¹uFl"ӆ-W$r]|wX3q=g%޴cZ̺Iۙw$Iuv<9Y&;I1w@wS'thJ90zӆ UGQF0ޥ!MCik&MZxGdWgV$3E/{Gm#C;,Gz"{{(Mtw0B[c4gFhl%^q}MJݔXϒIbl$tgSKl<Ϗ+?ݦ1ԭtq lB_ 6V^{/*\FCnׅjpqL sdM1NپJz(ip`XErS'9t$u!',@p8Qܭ!R֕|p aj̾ o?wSxJs X TO2[YE}pjM#1|4y1[Paz^ήOBDxfۀexv*h0zovY,A*ԣtQQي :_vd^ZӚB>KrΑpԼ뛇c (37dN:5η/oOY\QGF%R5'jBgz^\ՉTy]0h{S! a4]{{l99tüX1z䥌XENHrFooezW14ϵ#Po.4ȓ;Qu !"UGU.R@qT ӟ:MAD ^*uJ!ObMYXfJD}]Sb^2MF 2idׁ%~_WLi&0 e6LfZRC@P*)֕<-# НiX;~m蕣iU~"*9A@J*ar>IѥYyR~^JmID D~F_` 'Dlo`%>$6Nzl4 w)(4s4Ӑ^I{! -->9mw$}\4 ISk\%`͍-\׺pt O_vXf7>o45ei|$fĢ 〚 ŭ/o׍ە"=:dt*?a?n>o/8ùnR/խjhuiQWMuqOgjNj2ZH(Fֶ@9 9q5!Ðnr1D-= }*zd?Ê= ]L~F]4RŪ哠#=gh5]F< 51rڍhmlwdNKsK\yf8n;Vknbo2YNKC.lzx/Yז[zY-JғSjJ7tNbH=s᯾,tec(Iy6`('E܀Y< @Ypɷ+Iw#t[C/q@C~;PR(Mnʚ\&9.\RKq۔UVʀ+{ch{:\5[ڭ_5i 66=Zl'X ^!U};3wANX,WFRSmׇ] 3ʀ9z "+rxA q>Z%iPMǁ&q࠷Q٭PqE-ioE`GVP\rP=}Ꮙ$"cuFC Uov !S1-8X7ϪZ©w=@"=DRW}' Kd}-$P5vido,7` nK@5$lr&IB6 Ŀ$ð &G #Pa_Pv<- b\XX&C+B"U6H, *ކ-b Rs;j社lgs\*Q1(&W؊xJD*[\ItǑ;@|4>>.Ί=Xv,_}QlBfzgMs}Jh ^dːg;N\F| Ĵw|m-nHJʣyOSkFYb Y.a~(+gile8`أalp VZsx?f-2 |֬kq6QV'JŜkan`!ڇ1X<}/4v҆ҲWBa-5`#P_ׂ޶E NO ''L% 娛.1%EvbtBy)%5tEڬV~&_| }>kN*=X~_Y+Fl, 1)}Xzv?^^z1CFOm}"è=p9_e1z;vzy*ccʦ#JdFc* &L=c{"1UED.\-[J쮧lujR&.eR/=6_MXҨm!(!W;"ުfV甯96Ou'LM"Kb€cp{k#e:iеls\ednfwޜz﷦ȦkIj4Ӕ~ۢC/M<򐣏ʔĢ:V.e `]X aMHAɹ .M+TX%S,ȼj;!r_MBy}%a-}~!n_Y]W;o<@3A'~,Z'_?~ĖF`r;r>/m"-b*{чeKbL}I j^ -OV$Va e{XَQVeSAg^|.T9Y3XegFȹeGOCyڛp:&-PIζdbpGt!  -]CQH"#E/+AM_M]|ۏAW+&ٛlwNt͋)Yiaq2/_R@vlRד&쫿:,X 2E ^(r]wQzfT-vadaSXKvy_M>[""K^So@_ݜT $yQx 9$W 5~ 3,G?F>^!纷>7vmZpY]X^KA쪞b#䘻 Grʈ(uKS+ ݙCb NbA#eVZ zXʶAI*FPGWlXŘSá!]K.Bc-cƈŧ~)Gjn{ '$@DK*J玫 - 4Թj1.(>Zi!KςMfkSm $F'?3~OY̪pf,m2@ X@j:2bit] L0 =#> Ydu1hxqqUW4f,RRK#3F`{@PV*d;NBY!M[o ǍхmI?@bd8$-R=P4m@c^.0쪞L:gC cSU')K}AZe#+pCf6345ι4yUI:9v>JhG;A7D;:A#gC.n]]g.5&\k!{r| l G,BM1JL\;2eDA)$=mNH?\k@ɪؑ~D)GD"9ņ@h2t3_.J$}c['v9ʽb&ψb؜GcnvjxYX`Z8 aCq4}NQSs'_ NJh Gļ0tgjJ)_͒‹9h= 7FN`t ]8DC m Hyz|K[llu<3uxYډz'jŦ,Jk@DFA7sF=&Jc0 94ے I:Gɶu[Ryp[p;}lmp: CL ؅\Z Ñ۳S~ӏbJE? =kid9z Ey֜[(6˅''GxuTjQ:'DPrjB'V/Jz,KnW; N&p/;BA:}: ,Ri*fP4EG}xkb|Q]: }}; Uذ& I<R|ƒNI`ALh1(ZMS ZbFrm$?oI0:/KғQmFeAL'9N*̕LI1fP@ghEdW_ʽ]xWhRG`?y8|Msm{7GRQfaHI3aZ.ISҔ NBt]JjrЬG ,- =Z ;_(@! mq 3ZL@bG~|3s^\ @!Hs R u m@RI &GtƘr؁av`B)E?kXu~e%gK?7bi-̱0h +lf&b e-Ǿ)/i4.3 @&O蠧yqX>CD FH ^ &԰}oJD|C5351]Weшt۽ozo`l&f)o"vvbh>QH̉SxгB2/wla2ҽZ ҕl﯃Жެ]2^@#amOG'GёYXsƕsEe2CF$*IK$Qd1q"[-d4i7D_F,4]jixMG%eۭQ -YF[`:}YeF:T?<&Bi_c*Atت6d[DiCrDb@N[\5ŭ.y<;pv;G=}Z;B&1 +>d;Q+F#ۏ""TƼ,b|/J8;jh k@!wܟP3E+ 8uyLcCUQ(7 TǶlyHSZ*xl6!c9Avd*#9Vcwtd,vҨEpe,dܹ]hH1OL"D2 qk2Ó aMtwwKeqd@~YtT,pV{Z?R> /s-uPz2(9TѢ=%n:mg >aJK~YP<{YkRa?䣏2s3af@W4wMn5ѫsQ6yD7y0i9&CvC auX?sùSZAe(@:e!277(tP 9URv T҆:Й!,ג}KCL]/*)s|PH"\kZ'ܵT*9nů ib&V%MJԴ -}\ <oQZڍ\glQFn aZhXkR)~a]3|ҿ奀aN$>R/@3piLSa 픷 '>,R8bHq~Zvϓ%sT{&zQ,ma0ȗ,|hF X;Fr@dcwKZCQ¸a7ޖ9~Y`/9Kra:!d;;K1LDMQi i]6ߦZ@=I$ӉEUQv]תix=kw)$w|ʫRʰ}B'4:.A27V_X1<ozo Ǟk!*-6Y80a5@ȩE\`_r e^֔EޛnŜ~? EdAQ렳ҦQ|KëO^NkN. y ^Ǵi|7 Qw x\]tαZVk\I)f4,c!BB(_.q#؆8:UzDgsq}ܓ4yl? txm(V@ yWQu |Z)lPDB-d>̫Ş-H$$ITܰ36 ]ybQ,x%%+ !P-[2fPlrՙ=rO:erBAPv-W=Z];UA$4+'^- 3%ć1`quԃ463+bv]N?NӈFhS5%VOgO)X%1e9U]VWנav<3]faCE*;іPs&IeU-ٜzM#$!`nd\cI6 f\ts dpE" D>ɤ`)ti:(wU]%BI-Y=$:gd['=T~\RfYeꏧCg{u` Bc[ )\UjCl r/A% &R 1 \< A LS-yY'EO{E:qFI&ǂ=ivf(_,߼' j&C)fO&Uv\ ol7E:zG!HBhhӒ =JaŜ;p5E?bT7PW #wö8,{ rHnIhϧ X_BϾBE)u(Pan0(>Y(3)P{f>/F*f'?pC{Vdi} F[Upb 'Lh> G]zRC+ĎF>@L[#h߽rtօ` `#+SFo;|DZ|V6s!};'q$ |%-x/W@?4`b`Iby~ګsa3ӑis{ORk7\pY6y}yj';Ke^U =Ox.]]]c2_bv7Hg'6qdo_>p|°M|=;4k&JbEk#>떢}iLRmޅA֡e=ڊ/~$~38\y;ҁB1Tk/LX` 3tuZcwj4Rw>6Yr :ET5Fإvmgo=["m&v~p\wuqw|ݍ HYk)r^2 p71hZ5JGU~*|GO9G$CǛ;~vQhկn vn=gl~ŹjZyz\DpY(Y-&q9r|lXKVm7}ܵR*QȮjlP#g&p27Q.|~hF v*!A 5 |D6 ZM$29ȉ$*,~7AoAD`%4 K\.6>12-&_>S2,Ǝocqq{e8>(r}5:l,Ewwo.T)>?5u3Iŕn8c~!ǁrk40PK~uw :y&⥢[Zv pP)X!+rdM5ExkƣٗG2 v{+=LpdR k>B _AX3 :WgPn CS {OZ{"s_ >l|EIMw?#&GXrJ+CpW1 /U2`l:9Ewj=}%^"Q;'´N-*vWue9%DG-̸q4*AߕKp ~NlaFț20=XQ(ٔP^>:r@ᶜ:MX لY\nWF?CRdQSJw^JrBt%$MK 1( <{)@!6PG{o wewr-e,k?> ̀O 1̍.ܣ%]҇m泍riƌNzdT$Kms&DBުnw+9q{3 %WǰrwC!^nH5:mL< 1S@Ś)H-)5Jh3t.ӆ+hLzeM@4I؉X-UxuRAH^f7W<(C$+GLVGM6Rg^t1Fp֭@[UVSczQG[푑u ]y ט|M!aɌۓsLLёGٚEX}}z%8'M$DqWay; צ6^YKTYϸ^=~IIK&&&CI3 E6jh.gQu"`;Z'X(.T>aD JGj8}I[ꓽ|-ܔTxnR*={_"@U:󏆐cI-Ռӟhi"h j cU2$7j >B`P\}p<֩s m]\f7=OR/A1僼/ T"=||tH/؍ݼJSzs9{.FHl_Y=WM6)W7}]?0`O Cy_-I pB.A|B Waqz_5l 4?qzmWO+oZ. G=(a9`-ܤdcj F>B`*˜ c˴.[0  L9^ gӺa:k8-56 }݁$l*Mk.tC~#E@uҧ#NUI|i;y?CE%sO. eM|I6쀂/Dfbڔ'FGSv$b*3 oNh{5dmDd6 (>bXJi(ժE8;m,X 6:QZfs?hn{˹g0@bĖ8#-Y0ۄQ;2&ހE6_?]Oa ƒzX f+}&h7uJFQVWޓ 2jc* vBܷwJ{ DvbGGhrWr=TD?Q=7U$v J(o%0=IebƣXଏ!>wM :U|,%)zwez >N4(k4\z'xTJnOq/t" &:4,y/eЙFwE=5 n(N\N1jF.xĜ,1#=k@{ݻ=o3ט)`obIpsS| b,^n6nݝkZlBQȪ*"O:f1u=&M!ز/Z6|p>TN8-B"|%nP򢏿zP~ZQ>[j DŜP4s*$NS 2'1qgm㡶δ-kcZj>`~!KMl~M &]o4, ,r[ۉG5Ԫq9#- TP ͮƱ"p9AE4weH]f^w`r$뒸Y vM/F\#(M L%mmÿ?[o'O nP 'qs{Ul\$h"Mw8|lCs&>ȹn0H|m>|c5i_vig7ǒqAЬ`>S LollB e&OB,9OcVu>-OHlu5PSk Pe.%!$< O!H݁AWt eX><ƓF_O >T4%J%BͼCe-H&͍区|8YӤ"׹!eC//\fXTYς?2wyln쪍g񻵒n:AJlabDP ^.)136}3KYeNDAژc5O}Wܭ L٢XqM$ zq~2Q_H4k tT=ѡmpz"rzh;>쟹tݥ"ߊ7b%?yN0n8dSF^ҋPM1s72~qN4Yt9  S`Jm,uQEaΒGCemg[i:- Srys?kd/$gi25Ƹ(:[ap+y&h^YaHޘK>U " Ӯzю(^vG6xy =h<0{kލM|<93fR754:vLKSa t)3:o{Ԓ߭S;eC,4-tיt-{Ui]K[ "%K#{"2b) չ= ɱhqW'7B 0 WT5J}.ɗ]4ޣ Y63A%0{NfAR 3[;n) +*݆}V{L d1a}nǥR*31w:˨BftةÛ#g<V(?w4s)O3k%AwHŷY tXEI&rf_ĤeĽ^}2RE0϶U8'ٔ8G 6LsHL+uݡXƶtDA2Ğ1yr=?cibi9-bIPȣrVGpxDF''Lx8k{-12XD_-rhuqV,mTrlhGZ(֒g\b3PRйMA8iJkDZ<'eRqN?=[eYݖN5suy e^8j\#(tb(%^ ?ik>)9QիzJpOӍց# KfeWPEay{eO-K7c}ەo C@keeQ1qlXDqobU Cr4I>[ ,}3k}%[U1PV,BXшU#cB|;j#$|l"- OR(e)]\`yV6\pBɷ.Z^E4[*TZZp󥡖7bW ׶[E%bZu.ŮOCqaѫ3y}h; şxDwң\+ H "clA]X zso:޴atS-P/H Gt|kjkS+UљZ1Vf#βxM hIas/!\`lܫ{fbfӤ ɿ%b,D c Lb[ukkC \}Zisڥ}C~xۥx{!Fv(?YlC>N/]j#,6;_`\3]M_?@pђxq#܍sHR@%>8#t{Ef(4~hlȟ%֑ڙ|7nꠒZAht3-z%s6v>*ar, "6 0T9? ћ3J%Ι!M5'hJ)4.Njf_ a,^o>-MQMeϓrz۸I ᮟ!oYk D6 9S:TaN5Oռ_VP`$Q=Аib̲Ѭoh@z7g'bF|Y"JCu6Mv_GDA>04E%eYk^u s$gX;-|^pfUN" | bR쳡LG} xF4B{b<חdFoCՆ0 Y#z!-8^q`|\.1'D)C *w/~SPA]sej vˀ3'xIqB,S z`l B7b I06嬧6ˆ rqM@ ӵ]!uLC9":oEe=FIʤa7O.=Dd}DcrzV:%6Ɗ3jUa̶Stuܔj7)6 fĮӉ?:g{N6o.lFbs=C0QosǴB4?(v^5ir';6^@6Na.k9ҨCqHopi}V+\~n/5T&>~G4C^+VJ)ܤÞ%?k8* T%Mvj|kB]ImldP)֐&/&>YP\mx] %,J<krX Q=AOmCZ`yka 4.8*?f裏}w,v,; =M=걛C5j3쾍i,vgU{ܰ>|ԝ.)SXwt޵eg2L8 o2xADYdF~()fy丽a#K(΅ud8Mv`q=2u)" QXD/v}h;>dRH(tl9mpe0yW,봬]aVm!!:^7/rcȳCF3XX4=5ތqD/06; h@רXvj9Ӌc5_p7g,%Mτ5w aV\ 5xcS]l#3jVv0CZVߑG(iR.c_ށrRj  F֧{5S%_CQ>Dz=I8#$#V-qll-(]vȮ:(HGŮwK6OfCI\1Hsᰉ!y_'av հn#Tw)zh\e‘Ei\d@6W]~cjd73H|f$d鎰Uc r!gsIjp*5ދ pjB&d#:>߂$V]$a}(?ѡA>1LZarsFYƅpcc,]SF"=+`-x"iMǞW6eI-*S?܊ sO5I-h*"[D `<0. >L,˟1KU梛<:}2-'S@uӑ'ΎCzg)i*(QW~#)n%&Б89MW<``|6{ِrTf\J\Gx]Me)#7pNͭx`Ci}4/FkA0ju C?:$6iHoI:rNe[SG*)c '1PkJJbH;Cȫ cGz뎚% WѼ'}AW~ hF\,bPц6{%{uk3XL # BL o,fѣ{EX qűA T qItxc~DB9֦Q "tsrSsG<yxJdEqpL-t0?jּ;7C$x-Lf!$]R7G܈>mբ4Y:`8 D|+ 9.רޗ*̱,ԗE xym8 /Od Wnz]h _<ѱmtٓ^\oos|(nrQȤ5\0:.,JNn hzo eiht툋q`h.SY{ɌqN<Cסd6B@/,%`㉩毌@ Bi|]QQUC} i OGjC{kpT uĘ_ޫoAL9c xz]x* mcAK\(vWuVHц/(UNC3cB(a,AG=eMeg0>3pWwB,ը&5YVMMrq sQDL(1Z"A+&O4.A~@qx>VpQ4{h&ŗt"/OnO,rR5`A@w%U`n J mOQ4݉&DZҀ^4{P@^|=Ag.%m#Һ Dɉ㊊A ;t3T\zn{Vl] sδ\4pj[\I֍[B٪Ԝ Bs=E,t{4ZS(- LXdqvX˟atA)މ'fC޺t L|o{70\:ݎ^&pI]*WO!RؑrA;w/D!M!]1>VgNLD@_| C{埫9}͑M˃ Ue*iZ!40`wEٗha0))bWY1 ³ϖMJs [f tfOLp$0o/6`w`wUcPFќbK,/rN D7 VL!qڄowB:BCՠME+QFK6n9^K(+$㦣Kʐ:}ǼV(jh|(ipsDq4t8W#R!*Qv?AG0w+3ʲk>K&[Rw>$k%aruQ#9 !YǻN㒇OΤk6M0Cr>Rg* [3Xi~r&j(8ju))4?vî(Q 9EW]@\+\ٗ^86#(cTC+Ar(>yu*J{k ̾em #qtI87w0$ԠLªD)w!W~.%|Of:~U>6?T>?;YOB,/ov5~HVKs* -A?L#̉) ,6[0!;4H 믔',Ah*m~Me(ȥߗ"%*.$9~2~50sN&p{SnHD9$!U7MU, ]붕UEgZk[7a=Աh3\>Irf.i"]EPcAװ鑮 y EZXл27gaUS鱃#H5b<{|)]trmѬBRSy ۃx8$Cgwq\z?8tWҵeQa4l-'%?Zi[?aIm[_U 1 Bt JؾzkJbwA0 r-w\.i6 ex= zx:yx.͟.G]F6 U`m|z c=4EMLuWdm E|#t#AyuGv}=2N}<86gaLIl'HP_ߠ>}Var~ /%s=lȨ0~sۮ;Mvig PoقT^^SuXΙZl5S[F1-v ?+ C.ƣ^#Ǵ;m~~ZԌLvx>PM~5݈иk8)%F ## zgӠI=ͦKRaRn6ܱWm2[Ws'!D-Pfl}>mV <:05is [P!?awd-MD4l *+;UY{JdNW$k:2PIblO|\Hq@:U)zj U݆7@׽<6mu4̤;쬽f0,wE u;3_-[,|$Tdtsn]A%v èG=_۸-EЄv_yk#ǚ@KoǬj7j)ƾ(z(+/y[`͓BnpU[ ɮ!dACu=ګN14O=ܓx'|yÜ"1(8RL:ŗ+U̒{jY s#57*P̩DY愯T[?49mV΀w'0$_VͫJdь(1pGNWnC`423ݝ2F϶_'c l~N-RɎ]_9M(Q)stTºtC~zsԮ\A*'â*N!w'@He{ЮPSUR#yXwāČQv3XSi9#nG Xg˩rOy4EOhmTY֭r; n4kn߿'0t6rk-Ɣ[)RdQRRd+ vpiWl[?{\SjMֶ[mudZk'"ޜ⮉7GÃZO_hrW6i7񫣼ÅwJA'!0bR]=%q/n#bJh=>h;?؅(!p4uj(k 7 tӂ*X}\*כ'̢@+ NH)\ G7X!_Է{Y^B:>|jF#*G̪8eφv-TsRQ uC 4HsINFdo5a!,o=X pz:_uN4(kG8?"RTaX TW?<qQիTPB>>ĺi7z ^a*_._|4WJ( I mm~b[֚w)e*&y2{! cjл_dfL~,Ȋf~uMfL!J(6f6_tgt? uuneJJQ*L)~:,e|ʊpA4Ю[$e57R~s2sw0äD z(~2ckKM)7)ȿ.SچbFɯѼ'!V㟡p\#?HaJZ3`Ok#-:\2(VM7Tix[," @k`gȅvxzPQ_Gx͑# q9g|ʶ Rm!I'e >^έXu4g@'FZ` "y-en6=ԡ!2K"OH3m򼾒tj5 fJXlRdist'z>n1tNެete+bk7sv~@%wzǓsfFEh9 >d/+ mdQU[9@+(>|V־itdK\<0c'AӀb9,>\]*", $mRQŃk|EbWzP M=R2i;R}ѽH6}:z717ǾZ_e2AgVDIZ~q t97.fXZv3΋mX%tyM5 " e8 3 0WwdѱXڝ-(7OsaDaii%Uh{ŀyal;Syd9a?&ma vۉ]e1*pÎ؆ ĥηx/T"kt}O=e\(D-aQP,I La+oŪܵ?rZ:0u1:ZFɧ;DlHlNYXac\& !pTM$KQ5A·5tu2u2FNd5vD-6xFY_]O D/f%d.p{a:Y$( mΤ<ڕmN %&o8#Rz^_ & ,|Cl=(\'N4;f+V x&ZA>1ia*jZZiEꚙ$ jbҰ T׷pSӮ=6i5s+yv$n ט`)T C]*%r;!49h 4#D1`7E,fl'2T|{ࢿ#ڵp WP_zOJP{gD"p[ w({|}9!|`W[(\l(3EݚC=$Q1"}L8NzkdY*Zل_ɐaHEMM*׌݈6 Ff XK`Q)A<=i8SS|ng%t>WOӜˤ[t}т>6!FNS KڵfSD s`.4/e3P5&QCe0lHSQUmً\Yrd08?HMZsch6@L];CNBgAgG9ѳVIէ0w/ZR|SR1/6t1FGfF˳e@ޡY\Ѯ\|鍾kvd6tYIr4,}#YH%$ X]쩽՜R d= 9mqcSmmyl4zŃcz߈y:EuӋɶhΐhc2F¦Yߵ66U|rgc?m!V˘R=O"drJX2 Ě"Gl=FϺ_#՗YA{Z_PYD((&+ylpԢI$NH":HQ}uj!a/hB1D$S /I̗NKbP!)V15 !U+Z2 |""+Xش!_dF3f`=zhfQ1 o :e_, Qz}VӒwD&Oф{,`/Qaqd=26w`CLo9()?nxAxxI6Jsըh9rqKa ynŊ(ml騍]xDk2D? %ا"jSҊ].wr}\{WV<]}v!;zX,?L!/HRXD$W0llL F C 0ML5w!D4#b5'tO>;mLMm-HtPAόqB%"( K~*mgct){lhi*sX<\ϐ܌2TdsGBv&8%֘OɌ޹LJĩ 8y]%涥b'JM,ǥ&+*YrdLӝV'u 'ũ=ia {HLܴ`0Ȳ$8|L3WP r'2/1l#ba Al޼PxGɬa.Y뉎 b}@|gi> ֨Kfg)%G.-|f(1gwv>21S]LUg&􊻭PGO+63aV-0ajnD=|m=;>%D-llfG՜=0.8m9DwA;4A4kawM!kB{|3We; ,OW"&GQ{1s˥^:X!SA[[%>HhPvIc`T#h5F; B42u8iV@ͦ{z¿s(~q uP!͆= veΩC4=W#X8 W;vZ5>A&nyLP(D8{yI|8tudbHv"x zLN#[&Y]Ւnc3eҿ5G&)n;>[XX &EG}F18'dM;E e3Tz*7C}D.zm/T: vo#-%[&IH3/ '"h8nC G*y?ݪ]0ZwLVaǽ,q|VT91cSQ˃V(41Μ!H1k;WZ YL_O}d>4֔3p*NS8 j;|Ds%k3l%gxJs0xO>$HugzxF+kW#5ⰀX,doL[ v2 O:t_\+.r#^ i琗Z q?ɂ 14^? 9YAuw2YҢ8aCtqu oԒR_1|1$7q2rЭbi]XyHւE 3cM1ُRަ#B{VSM"fHNG@"f!Ifff ݏLAOFr6Q]uɢ(+u;Mن$`V(IH$_Ͻ*֗t} _c>YC9V5~6Oԃ6P4~[?/vd!r|(SVȜ=^ܛE8݅"$IC3b`=6<|O8{G >YƠ@zEwAS<6A '0bIxQkɃ.~*/ ~Ri x~*)n[v WIgT=ŃMr6xajeeq*0Mpgl̻kdN뜋U1[Lk=dH.6x}0}dB>dh8\K͕}Gp}n+;%ݻq㟬{}7E͙J:]Q umA8]& EˢN؆h>7i\"dFqЃ`P1fö &8IZ4byEҐ+'~NrYΙx Gf\+}M.LNe:_V+`Rz.G3odS;ܵ=mVv!,ߧ:uQ|[5}#@|6QNniu;}f:a6Cj"ce΂ff:e y7e@ 4UbG0{1b3umٿls4 zH!IgxbZ!ƒ*Q@y 22 q0%cdI'-YxN(5`(/aGOZ7N9Q2Hm fXkJBodžG<\ުRCH|7-KJw7z,jA*_򐔄tOruTS?uF|)Vz]N/M`*S6e 2+&Aۅ4Cą !' .]q F A&9 q@,~SRܚT1G#Xx;1 1rsяS7 ީԞbE, r"_9sL(y;qtV>trr+#D *+)4GKxQ5IIsu|G/Ɇ+ΐhAGUr=xuXhaHENǥ)0E"YWDYX5qrM")D@m>mA)T(1mujš_.c:fnD.E&0p'5'Vހ!XvȖIYҶՒTU<1?* ;CtL Z]PR"UsҡFQ37ⅾB53iF *9 .F- RgĦ`RACKz(2Ca7c~es2a :k} k]aoL+L!b/t6cb@C(@BHz-\K :uE8iu΄^#ȍaAfhH:חP*Z@(2_˭R,^mN7Kg@~ćܖ[hB7N'7u+VO>Ddze2rmjL1k7R|C|vٗ m/MHW*Rl+|E݌*\9heJB80s@v|^TyYIN zGPs_x&wk~V~܁_Ҵ?x4&N޵3)P$_94a x] o+W/n-J%[;.lTaylpcWC]J܌ed#GhƢ袽< dG15{%{A'.Y>zz76.;xJ*֔d|lѣ ӡCZT෧ !O!rH^,VRzg&Z!fsh!^Bp'#F=%lcsI]nt7Zqa*3&%j$\DsC|qpe4lHlx O avz3Կ͚iߙ NO|y"skK-EF ]ߝwgZFZ -pקFd|?YMys} | 5|5 TyIR=A3}btYVJ䧌m16,C~2քm:]L9A̤;pɚWBw8ϙU"-CH*YBXR->[9@.2֝LqDJ7=aA(i:@g ϋ^d`L"\ @:rTH7Ɋ'+g Hu'f#s\Yjэ+o+D [Yѣ7cևgwJdgC`7_U#)ڹ'2 I/%  ~W7<>tV -k8|iDz152ҳ)"9';`U:8yR£"}o>9T{*97נswW\oսs½=@=\yzxdz\z`rWM'J.[$~JbCgAdY"*ͺ&>#iY& 5r?CqP7\ɸZ"CE<a(>] V@@*Pu^Lהu8ϸ.2dC_?,m'ž1Ɣ.r3UO'C#!hsٟ\e$z9."&w ȍV.7v۪V v]Xy(BOJ￙Qbg 5;#R<~ԙEmTM2of`!&KSNnH0(Pȗu@4JG${\ YEIus:_d,NR-aV ,Ir+ l[y1lpG1#s1zm+nj{QE,<@55Kc 7\e+Q,MLK _@0JC.^p|ڒv] (6OM2 `jWC$ȸ09 a-qXQGS7(A7"&|ڂ1D_dȤ ,܂fL@۵uߔʚ\#<[F^Vn{!@6Wm/-!"a7I 'Q4_;((MV/XtG޹)mK^auFlGiuA3RkYŴij緖m "+HthRqtKYI⸘LikZh% VY)smG{G͸)ow ?v Ԉi"du ?Sг@넣i8j4]s,$GGw>q,>\IG}CX5=͜ߍ`#T,{`TfpaT!I7HJ*PUAe 52-rݣ<b_:ϙ"Pd{054} :_`:@0Ps'^j\gg`.Zd@=n+8P[hf`cUz/{`qϡpR.G&t^o5*'? GOaF_6#1޲&LhXvHЀ,M9 ^@KW>-`جЇ RN5Cr ٝ<6[?w8iAZUJMܿ$i$aWj0 t\16?fMtc'`K Ug5ViZhfpx,Jz`7Jg0%@5eq6|x~@+<~G&.ZI#ߺCިagHQ@+"ъ0`Pd#u+dG5:>luqU:٦-S&"vNڈJ`Ht9fu `ڹިҢG<}i*oF}5P\"= ^Xܝ*sKp9#}yUX5 UXo֓{ʊ W׸Gǝt-{QT1+DF;.o0Y&DKHN j&hŗA3姸+@3cR $.?\BL?aM !LMUl(0on |Y\k*QYõ)U࡙U+fX9Ba ' A.S VFZ\!  )\ͬ6d"%c٤Yr3r<@+cCpWI^0Qw!3[AS%]eRk LȃJ?͌m0m%ZGa-- \4j9 Xa C򄢮r7݌v8Ś%.a^+`vf8q04ݧLV:/ۼ1ȪЎkXNu<4{Д 'qjE|IԏC|h$G5N˯DF"SG2 }R87n`"Vx sv#V۴Z=&Z@,@h+0y&_%酯}rbv3SstWWc3t:RZQC~{nh.sIi2lym羱5U GI,jq#0݋0(@>@{s..E)9 qiXnM#`'/ME/<@@nunِC?f83ăQ a#5ኤz^uޏfHdU_sF 6ہx4)r^:0RW#;f96%Uj:,eA*B ũ&rڤD>|5.^ژ7Qfki8bN^$Oip,Q"iV+cy^嘈^<4Z"\]-_̀ueq\36/,驜APtT!B`3( n]wJ%2?*/'6l}sA6yFi4d̖wJBz0ߴNB7WP9$' :wQȷϡ9.h|? Kܿd!s&`=Q=JT<?!a<aQYf-c";M{YmqdߘEb%EWkࢌEχ!zNqT|rpV1rVUCDۈW½?@4~n)d>6FPxIE}uTZxO}<9Uz t,6s{$h+u0x<^+`w.>b $^hbBU=pLqT [&,sb2 YvN`<%>"x>]-8P@SH]=[D>dB*]H?'9 rEo=Oz\;baI3td-ˑb ͟4yB&zo zIfjh հG B` jƧXK'DiO:]*XB[HR4)kU6rhxg5$ fHZ橊rK7z١h=R4mO=!~bL U͔Z}bݜݳ""`D.72/Ab37e(,dt~,cbA̯U*,}%b I%*D*Y7raǥU&>YL|-_-_v[L=N{Vи5d|zf I3YCHD<z3[d;d|ܽ]*}nkMfeo@9!XGu_A&)0XXoJu$TYaEr0*j T%)qc TrLŠ{!] ,I r *j-/hgwU6ͩ[804Y7+saA'8Bmt&]˒r/M 0ybU'W[ۣ~]&xv~ɏ=U' 2^ry;a>&vPSMVwvs>Cp/,t[5ܛ`f>xT[Zw2%.RvcI3Iʍ5;͏/!Q`jY}o!2"_`iJxf{swCd3Yҍv%ni p Hpsťh H ٵז Iu:X@hrF h$V-0II/#[9=1Tpɬu8/Pelc(;:-eD*7U}iiشFJA5zezy~{z!Bh~4Vq(fz' |b*paZ%Wn{dAfD֩7\(σ0{ZV$Nr5x?87ؔT]%ǚ17 L+p. Qqxwт-vd۵&fH ׅ yrmaiB.s]6 h"nH"uv2L%'\n؜ױj2)~%vi.0֎G{%bEHa *4yh)Uggd;$Sߕ9}X(tɪ׊>P#x(BE-vye_ #T18\D9C`PL"@.  ё[׌2eI(Y%zB[p*=ώ"iޏ|_t:x$.T*2bjYɑk ڇ/@ Pћ+*)4.)Kd̗@2_QPbhv-}86"u牎 L)` ,gn6D’sX+b#Yz+8nzULjFMLarKI 3J[hb5eQ;'v,j=gW,-H5p^K ҘNZOgJ?FV,ʣ~(u\mqI6"?3|9'4+&c2>Z]%Qjfzv "QM .!;#h_EhHʗr|:"{.qdGܳ>WAP=`H SIm. >ӭo \zA(8S#$&dLJ:xy295 Yrf9Y6#hc;2z 6fKK]{1Ύ(o Z&ψgHb!Cz}i/Oӯ?ﹴrk.aEu}MlyCX>ޛ_SCTnr>岱9gVDuhArvArԘcZj]cATkړW YyU~qahawv;g@>zknB|AYxjy˫s龨46a JCKn :*,nK08gXO9ox=e,-LT Rhϓ+$\`8Ufd͵B[`̈Um#@/"+ =,fq Ac QuByb%Pl-&w60LçSGesTat{6733Xdlz̙/OX+0|4"c=dOnHN /<|J%y`-?#PLt2 %'\CCh_;pNtL*s7F(ⲷAIi|L9 Z2@"EMj+*avnCr_*~+U^~,>:v?W.ys%) Uym]&aK N[#וlvm>Z7:/ u_g&T Bhy7Y6z^>a8T]3u;-(*-:V'U٩"3jBW#h_'S* ]ڼϬ\9I} W:O:MAKiTKs SO65 ȥfiMY%`Sm<Fm2wExfM D@e%A~b嬨TM' ')۽rv1CP\zAGK.?tu]<=u SDkȹ1,,RglҵC(;Η$Rjf:[1m歝k{@Ir4LE24 K[)\^.bVqLIi"젮څQ3)X&S]6E~xԱP;RB_$ZZoYM0Q.t@b`6pb jҙ!\n]e$ **pFpX H]"9Bި[dJ -I1[D5!fKeAX%ܴWQ xɐg1dԜ#T2՟XEIgOdXμzt@ng]W |Q!=gKrmQft#G"E"zw_/L3tKkhy`{,Liu9a6 }yA9jF醖a_G? i#tKsmKՑ5\Mc)Ldhf¨6e)Y(˄w1PIkaٵh7[[0;cņ VN R>o VߢOoJ2WA(Ya@ڱ@DQni>{7f{/|>oLQ#:D#t7ZUΦ#͡7:n9"51 ka#rэF&dԣ^E176fNg -GN)Z/~`̴o5oμ+Y Xr6޼^]%MZ+/T#}65OB d)9,bP֋8٦5̇=AaZgȵ`ǐ$t"7 =DA/KڑRڮ01mx`Tl6E'"J@'eOCmt89.R"!(V%5= u8 X^#"ӒXBt3Z>V5E&@-בWP/0V`a(ݕPzKa`qD0@ +d@*2P@}}`D`>o,[v-8#OC|Ϛ^AͨW&fv*t>b1;"Q(ﰨp c^ 8\K+zTctʠu1P9! 8C!UOe7|Lli o3#MMBHcIHkbD{n cqzZ׶9`p>XǴQc$j o ׼oZ"0DV75׌aLԜ ]tJAjE@V(R:7655SM|n#*YTxEdfAg'XpPA=8-3A[ uO)²KOd++&QKU54rŐ3BtljFPK#I)zKNYśxRJ`$k=LjdadR_J`Ӧ!I3h>цm֝p) CPQ%⾯d;ֈyhmi[J+_,!':n :ebN3 RkS;mS]btj%ь5-da 7rN䜀‡P[/1]u{XĹñ;'\ C.;sGq+3lFꛑ(1?+f5bv6 [ưT\ԙNO^3eF&6" Ӟ'xl겭Nkt <f8_e91QNL 2dWL!8* zbs '8AL3 WNnSNܹ)n<5G*;K71&na!DL͵ `Wb>$,B/'c A3Puߚǧ[`i&>~\ NA=j4 M:0nHX`䙵۵-RE۫.j-7p0Й༩ss3Ip EB ٱ$ K*Wq"_x#ǫ=iQ/,lzTBmm(w% cz+#wR 0"+BNG24v0lUg~mSY+;=fݶ  Tvdt fqZE!Gw$LdɾUܔeLꩶe|.)(#l̄IJ/̄-[_%r e Ka$J])ˤΤlE1xK2-8JgMl\ΤԐX@ʩ&61@ fΥNIDehaA,n*L^ #> xOҐYjInc'Ae:oڽ[. č1 P@#HhÐ$9e8nhFu]%B:v  $6uh@ⅾJ[<< MA5A19bxm$6 TԴv(zxYPFÜp>wyL7& 3,k go8AL 6¬iW}`PɤQkc+h*9Kv K"֟LPЀbn z`Nbgo.*%Y WZkc%ə~CJBÍj]p!up!~@LcWQr;D=ϴAtx06䆢{168`dm2TB{wtH`b,Xgnj vy77i`Q-R(,B`6ﰰ\ EW("o/|3V)ʤ@rqb[BZ]cnHuجokuTg]Q>ʲ\,abH)v|ЃDDez{}7A)=Z]q F>4{T(0_Ļ{4tw9N]:Ag2D=yu^XQk/ U7ugbuUW4N ȱLM[@!GHa@xj$"*q3S!S8Fǹ Qkl]2&(NFZY +W*ٙKxLےg5OIjƛet(Im~KMY"1q)I`5T(ܪ [y7 o-w=##ITu5FÅ <[ agk]c9U*d6\q_ӨH=z(slO|RYZXK6a&TsiLؕt,iЦZ86j`"߽ H6-BU,{T-K0Jn}r8MI=ȕ 9-ti@ ՂF142-Hfn,R=;zt9uu2wrrWVGkd:&ɾGP߰qr;r#3# '|( $\quz"BXu7WRq$S$ P5nz1TcŽ\ D@)!J߻;ppLړj=AUeAӎ6\ڟYx070!Op<]͞W&>X!Xxik`s =tfUݲފD!KqbdjƎHkYGlR &JOQ)dɺ ;{vOTF!h mJ) dz||B%u k˕}uק_8e0F 6 =STtd>)a{䌓Kg=,sK_ҩ{mi6:HG ) -dBVΛyն;iġʼ'f "N)8K77+6hrؘ5o- |:TGn Ұ{YAzU5ɡ;7'ᨚe[*#g%7Yg6qv7RW4ee#9#h;1i` γ99#׺lq_d+[j4%s!aTUUk 'lm[!T4I e" 22Ue ]=O ~IAkl`3 m*5&+I(.AZ2p%W@!ac0I4y87p3!{ V59 (X22I6SK$ VcNGD<@@˾\6x$8+B`I|6WZpE3f$xgώv$sgcv^21pوoO"\yPޜsȕriMo:[rWgÛ|[Ds(Z/AI4ԦȢcV ݎh,yrBӨ&< U.5n~g\CG-NnrIҋ]"✒݋gau/EZs7x2u}ѧ\f+u$;,da@ci95&dNNe p~44OY$` ݦZ16⒌ØB, 0 ̲!UmAh <κud:CdBYS 5mfZ}nbW9OוZ}%&]A DP!uS4q*~>Q`WH u=6K$Ϣe&[G ]ZZ@B&~حHn{"%BDSP3oNJ1+B;۔B=,[մ;md˚KxJQng*J.}(8V !MV0  ٲ([Ei +4+XJW rŽA-߮:]؛0<= |mHo>⠄s{j y*rSu14 92 渥)bA Y/NP 1Rm]J͞LӬQID%Zfm\^وX/Ո-D -Ph23 Ă΁o*W%af6w~^ӄ:rciAƋ'lv@CҀBO+QpaCd`, GF!C$3ao|nz)lvWtH ! DWDˆH-]U! We8t?+?6&$X@+9fh_֎kS6yU\O:Dٹq,/!@D !:6H@$ ! \VՁ&ũw55wp7=! ` 66K3OlMxc٘e5[z5ڄNa~ǭ}f"/auW/3 `HuOX1}3}[?yq}Ahng3ax p;/'K4gp4['s5w3?_S;_7ީ_'~?ߗǿ~ߓ?`a?҄bI&zBI?/XD +'|}+f,4N4R@a$H; Q%eب aA#W948ewk+a6djHva ph\%78%M<sڟwQ`hM3JjI$MA Jd-Sd[KKedײ{ M$Y4Rc1E$.}r֙ d!쐚L?i}B>_`B( CI$BjIIj$ ] mYFf9N7tpx,b p,7 lY! $@BidIB`ɾa'-kOa$*:wpخލxHa$ް ,!Bg XH%$HN4rZs !ߨP)`0Ń rf0,yPi 7T'X0U-)^rOi`?U vImq=Ą5Xò&$^N^#&k$$"dHWﳬ"A B%6'~?} @pyf = ²ԸSH`P("$S~Q-]ugV,",&%BbK)*ejfA! C|$ !> p4۷Nŧ\!ɦv#96z /G2zk_$!ٲ~nY$$b_νEk2Iɒ$!JI6$ o{qOOzHOPx6$s^ⴛ8MƂl($= 㜀izXrW$,Nٯ?RͿ-kV~ο?${Gs&00څ{d2NtWJF%2YjُJ!Ѭzu ȆрlehBAHq@/v; EvK@ ͆ I!5=JbDEU"HD䜔QQs@T`.]Sjb,v8R *'6~oç$2Nݟ>m6I4k'R :ޠBdpld!?7F@C3[D6/WU T gi?76x:(RA>gEhq$$'?j u!p5!8{j\)lޑYX‡g[B@0'Bf{vg?w4l浶&LgvY=rI օ'V40db ͨD#7ׅI.y& ܼ༗=E6zo\f2Y- cY$;tkz!@o'[v̩{{~֠c? '[~Cr4 $?;ׁzTi7~ wI3:cα4UU\!jiJ!&$*XG5o&_Zy+rOWb3I7z!/ͯ{y_wջ&e#uqV@k@}{!?QϸҶӻkiF )-)[To8t.W~=7BWka3z^NB@ф́WU{e 1ZoNJ |5ca=wRǔM!ùa{ؐP vGG鐈 vK֜(&q_>r !!%3\dԉ;ﯜ0 .L 껞\D?:S,G@XeR74bQ~fWTHFP6/5JF[eÛWG";Wv \-_Ezoi>Y5-\Ф2AF#S:W- @\ř[^SauD.XdNAL cK[SLWJaBL_TFȔ`uPW`chc&$2wvri9Z6h* ;7x tׂZ )})%ƪ 8__;AڤBwW{̼TB߮h(B+ye >Ph߷UsxQͱ<O@0?̒P HxmZ&AB`4 eJ;^nY I%'7aZNSb.Jw>\=`|Qn7:ƖZɈD C3I ֔w J ޕϾR"z:q0B/֜AYPvVʳjLȔ~KWly*CJ875k2匝7zxpb!½JkjhdMMS~Τ P8.@6=y$Oqпs&~ v?.~P٨_VˬR&ҩU%%D:oC]a8y^ Gi8ސ #`PfaaUlub!Cb'~@b}T+@O.l0ksg. ! 9lVEqw=,|F T0wޠ ~_(4?߹fn+7YAvLF֫b @`BOF &3HN)|OH;W٢`VP587a|oЀ`{(Qѷʶ76 m4sETq4"4KFG׶lq}y!`,ATs*^.8!w?Zyn)̳0*T[t&mH2 (;RY[4ݤ`Ykv`L% 2-lGOn% K҄W?u'ůōg7 &"8,W!z}-fʷ)&1&qf CB`fiڀZ'1 '97h J[?;ת aӌ7_c{XX3:< ^5٭*\!:~3?m͖vZoP;=c AdWNeiHn-b^ `l2 x$].Ng- 3> 1v֝k{7f$@"$F zN8[f _^fI|CA €EVW\|ےQ.TrghKDij6DگlF1 nP#Qdn}3M<Ȣe>y bScM6_fq$ |j+iY6лTqRQq,Ne8|$8" &P$¶۷f/I$D@?eڨ+j"@rF=$1m^ -DZ)%?ёjU :`;"KtT_ >^>JHj + >LJZ9tvZ}71F-+9DpyurV;k6لͱn6Mn}9E wI K5b-jU ,S$$(+tےbT)@3,k{ozr;k}{Odvۼ{YzmA`JQHD)[aa[jqdclѨ5ns]ɀ^}rg,=^ 4IÕ5W9S;\00Sxs.zgX1 ^qWX< {IFwoKjq ~ka@),s?iⳀ^5eSN%utwvo ,,~Uϊ1H>$$2g!9 ;t$BB$aٰ 0 I'aIޤʲ@$5>`H`$ۤ@g CHj$$@$` $hMfm3u]Pghi$I!bsvR⋒s:Z޽3 * }t a }8eI钀I$A$tH&H4MI6mImmmmmmmmmmmmmmmmmRDDI$%mmmmlmmmmlmmmmmmmmmmmmmb[mmmmmmmmmmkmmmmmmmmmm6mmmmmmmmmmmmmmcmmmmlmmmm[mڮoUUKw@ ud$ HH'a ;!QeB@cMI$NneЀeI>XHkО%Q9)jB2R@ d'H Dq,L8B!@I j$$&7BHp)d5Z F =[,sW}bߙNYkz)ͶknkҼ6)e@F PDS5y~m^~>/TՍp)Q!h%n /iT ֗{qn H!9!EnAGuغu6$aHIʤ4wYBI6d O-!2 Hl el-8&d7wT`,8<@]D !bLIMjk@:+%T$P wn/f3pj)sl$BIUxt jT @*&cmřfC9̵fd@1 oΣN]amءoaZl$7lE\gEoKH(iUIL4p)4[@6o j$%N a5ɨS oH#RzK\a7lHQ_S3eRpn(#Ȓk$XBk3s*@@mvu$8$f $V \ CBlΩroqxnΦ\QU^?ĕT"D-=6MIz8D0s*oDbE7ߟW#q8)d\Ϸ$Ne! qY0œn us ;M&cX5I& 9^B(!5_\k0Jq =n-;Dw5R_p]q<cln_, HCI9κh LjsҘ6_JLL&nk+A65 tvo+j(L lg dD&s!$*N-$ڳ@9t kTQΰI3_߮TI$ih\Jlۡ37:os7{-kg㙶wV7 Žfs*RmMl@7Q̭=t&gPΫt4mve"if97 ݦoSawW`jN!5\CJ@ #{hl7zHpc4X.u.{xic- /r3Kuzae .fV. P6ZgB C+rXs\U^$&$'&6~ҷoVT,CJ"HTg$ʄrfDd8kb[͝77LK]Wal7z ĜI '8Sitna!\h(&S6jTݐ[qg-&^ |H4$DNzjh`4Ìu"[2m>#K蕒B҃gI8Qt)9o`ک"Ų^E14JM'FW+3K[ 8*HBr\1*X`7gs9 9\b B,2Ѫ!T. QP$PD2`^]F5.&&R9JK )8 J=$x֮uyꛭ~sJpSW1\MbM)XPI9uږZь% 3AlA!OB( $atgg5E OBa` Db UӱA{J̴2a2۪Ӣn٨`1KcX7|}r޲UHT:M0UF=JH!YYt{!ϙaU =)xW+UO9k  V5Ґ^hnp&~m5թֆT;˃@mH"lu 77:l@!xSdk^S-'z Bx5Z{DuOяQHW?xB6);gVy6@sfzOu|<`d5>If8ި 3tXjF|#쵽̈́-< h$;`N~76nB ePi bP!>NC @R\Y`â1´`9HAm0) M!¸m`PN6᏾JNѪ2.A{BNR rb&熪AuriW$U|#BHF䨖0A7Q =K @'i_Q-h*dm[v 36fZEgYIӝ(tգPJPD- W洔ǽ=i2rukAD&"MB9(u>$m>vi7͟V!b:AEBxeT``ZcH[x$C0e@B0$nk+]*`ANj1qH(eAn j&R)%<C-9m5wa;ۮCW ի 3J䷚[MG)2G%`ϭRto 8HOoݫW;կV&Kl5g{I&@.AYe[ 1[$8҈*Zxo~$ROY[.̃kKmV2Y`Gs{`#Q17 QwF1MCuk=FQȬO"]D= #v"liaѪw>Mid^.b!-z7YOxYE`cq*b68r\|QLF00CG00jVћ POlJa>ۂ;He Pë.M(TY^JX~&J`-qu$H@Q0%.a 먛M\{& e]cPpkۮ5ߜf4-t9lK1RVv9 YjKaWg5{;ģtp=<_WH$w*Kz 6@( \xs٬V2bsA8Fmٵ2nl@#5z[Cϴ\>'F'Lg@V5XFy{ XLa.m{Ee`T dI.GcXrXdó~ǏY AjGbhQ,;余▣I :Johg!s[_8p|Č}XĐB2 뗉5XmhaF³kmLfp2ph׫ 1]6zf|tF9TiIM1 IC wnA3jQYP 3<ʃ#s-wh:x2CĬxI&i9oVXXt].Y$f:W5VWb{#֑U#WfU((ۚ%#8CicBHhA; k|͇w0cwdԳco!Xv@J qBmX8Bl(V,{M煲a$ 6Ёm e4<4qDeJdahGRF.h󩐇3ǫ 1)CG ˥=Nf0.3qq$;,i1nfq3BFȔ*ʠ ӷܪE pC9ksgi=[16Imz$O1hvQ@yMZSQ;XN:p^L_o(^ކmQCi>Rml`ŝҫ(,%'2?5 !R䡦ɕ v8oFcp'N=NJ}2ݐ&)~nsA( ­k}$P)Ϸ$InP%# ҿp)( " xDᝆ|șISQ0 r c)o1Z 6Fh@En,OQ-2.lI6#ڙ&@[Ch 쓩FYf-+<7)!P!" NJ !P Q(3Ȕңqk\YDiHaJ Hl8YKZbB,QYG4"ޗ*;{28|'dbW&5D+M6} !BlN5W9\<-H4 z]na_\?Tqo*fEE }Y `#>ܓj Pu;s6e2d&SEs_0 _4oQ\WLe.+ t(ikϻt6Lq 5XzLֶK7]4x0@0G[H).G6ǦرqmLsmӺp gK͕`kv&q RH"!X{z5u0SK4Bt]-:Vըrzs,B7R=M{ ӭ HS"̉pa FaY|i. Ha%2xkU,F.ٷ Vp TTA6^v(lH$Q]ܸCk#}v8mӂ_[1MUbR:"C rnVJ%nF8 9+rf4]}%}s$/;a&OIaP;ن3@":DZR lXkl\/ h tDD~a*)A(H8$LHtW/PVW>.D5c8ZO`x1vv zq,uN9}\@H @ -㑌7؆AD `#") KĒ_-]8 R:sJw*:_fu0$-_t&iۢ"-Pnr'h{JanYٹcSIAek@# \x+{)mDZb]plhm7dn:ֆ,͚NKWV] |Ij' c#Qd_8$,j<sUj|2aEڙoS7*""A!ؐ!TDPd"X1Ttqt$Qƌ\ Ea6)gf5Ql{/g7.HӦ0dQd)Sp覉q&s3C"xt?b̷?cAJɡ`s$0HK)%7i9gP*互 JV|51wmC"%fj{BN75{&I!k H{`TJ USI5X! CN(,6ɺA""\Fma"dUrh=L%WSӫ~?1A]d)*, sPaMXI0ƔH BE)S$ĔfU+/fNi:mN#L4 ) ֔bpJ@jq`@6ΘqķX]9 !G 7"@r8%CZ;%ma amhes, 6n=y$;}"[5r*cn @@)@>U+b#՗ @HyD , 69[ۺG- !~Rj4 3\@" TPfrJǸqf3ax# Vnow"*ٜC='R& _[pD2y5D8) -x){Ր@P""#InXi$@0lLU٫5caMBbzYqzgH4PH tVZ- mFG9b4kxǥ =ոGX .p X4Υ?AV(1Ӕx/CD 0aB,9 DLKv&²TaZR]IP0.N'vw,K 1Dc4<%f$ʪyZt .L<ho !#_8@5=i7kLfLoYsIC7S+)jUCY lf ¸ӺJvNm 5ʧ V_y~:x&;EHPAN1H"+J38 q@  `M5]*SJϗdjj@W) "g [ݖߊzdI8te 6oHPlϘ8/f #(N&qptPjp;.3dB~B:crc$.ˢB9osZYσ=7K\M$orE"&NUs1T ",@n!a!P@5g-LbBWפ4PK$a-Ү\e#W)bbkW.qn;TcX4@oEX AI-=n5$5J3B) s7-]kM\LⰠB@س7xHA@9ѓ3zG7j5ゲ4jUc\Cvr(ᙸNdvLw ,{h֝YxkN5-RICCqI$V(T=EI 21F6珟Vc.7_Q7 [RetujfpI84ݍ<&=7u-! I!3u0$h#s[$}fQn3$@-nI8y;,qfUo𺷄ٳ5 S )WZ@F}c O&-8I5 "Ca%!]1d?m5짘0;3w "F`DQc׫˶ H絅d$kV(Nъ1Mfb@zGl!Q8`wf꽚#8u##w5sZS hhO tl]e`TZckJɍHYq!\۱Z#FRUDO 8%$ BB㝲o9tqĠ <5yy*7Wl(&6g-ICMfԮ=5=/VsG{Mma»= oֻdRI/`V $!7Tf(ùn^2!0P @Tr?2:?̮($ .$YsN M;Q][$5Pg9iN$婍Y@ ¹D a$ [Û?/=ϣg{yT/D ۾,יJ,Z>ev~Mo Zk|\7.zׂsrT?s&eaQǃR}, ӵhEyzNmUmv,O6{7?[1ZEjSa?*)+q^>ޢaomn4jZ?30\ij'Ip֊)3g{ce֙oQw,װf{| ~rBro:O36?uF'uz= 6Ӈq 2N{k׽Hv^q[c:4oF=m4?Փs {\kKw}'-2KV(Ƹl(NSO>56>[s漣z~B)ldӫkۻu~/xX15b=-}tB?3fSt|fz_dw4'Q[`iZ1?kf魑OY~:UB˹McW֚˹X|v\; 1 r}[!E;r\. u J ߻MSF{J3<cI1i;OƦ]c zR7teuXǵzcazТ%\uCvySKØKa1 KsQ 3n}B֫-E$ $ֲ `]kz>59jk7؁<ϾћakhkwZ = fYnnn͵mמ^3y<^MZ6ujsm& ƾbוo{ș8޽{j[_=ޜ祷oM-(}ΛikcZc|׵7ocћoMX^Vwe[gֈ#ݞCnMKeJIHfZ$L!iƙs^fHr5ȱ x^k>v٦ӳmh'޷/|oۼ{hmj>xK=ozkսyymmk݆ }fӞ7kZ[٭g}i9mzy[͛sͦmݲѵi{ewolDwogF>Ӛٌ4Han|;k f=/KZ^[/5>{;nyy4/NeJ(A$8v3Cx& 9I'Ӝ  H6Is!2 1ա!Zv}˜r9^UX `_Zjhubk@@>آڂ̀s]Xpll21 ^FXH0$nd cnLx勫ry d'][:JwxLʁ!$ J(Bh$:5,kR(XR  B@Bt>&[蹓5Y! $V2Tir^LHr%Ci$BIa$!&zHBBL εI$ slHE6,"A~.H.^EA0 #H_wVsp2}ˮt9M45\&bIED$3캤s:,P8sZI!$1U0\b7efltnXa{eYPDNlhXѝqo;b AX9Pq;Wye9bq97(F0&8,MșV%6 )4;0jPF!$Td *P 8YFGF&]I `IU24D%Hf1-dmr$dZ۩A_}PJleͬvi  ٳ1$m5ފ$Hڅk\ܔUM6$ D׳F3 Adc$$SDn1"$2ןCA&ѦLP,MQH YEY!UǫXe,J!jU" j!* VB"EU$W^ťVЬڪ(F\K*mZE$%*mZ'efn3h .nJhf 4uل7H$޲D`;4FRM$ g4E;X;UXȖĩAQ `M1Y$@A(hj lt`)UA(H`DH2F %H.T4į3\_kן٥ؓTPdPa)HLbL݋.+P6\fH(HI 1IB$"P(eeЌB@ݩ3d3$!?}$(E!k!2I WԄ:\N$NIE).%#DEr$w;$I""tA::":.J˸.JHĤ+rG"G NJR IĄ:I8#RsI_vB!rt.8 .$p.sG:H9:8IӝGQ8sw;:H.q DdEAT˒>6Hsh i&m^YOl$+N;m=am/۷iͰ):ko~]_,ZS42X0MN81߇<] ++/(ىqS FU/-%ebrߛqo lD(K6AYRs$cj@X"XWT`f15ȱm;N5vcxL`eql"HaSRh5TTff%9eDlY$(#yjAu( d6 iSf(r4IEK0MT %hD cn`E d@{ ZEQHm@ * ɰo ᶁ5[o'BMQ@aĢ!$8$-}IBplwBB$ X!P0"J Ԛ-%BM!2[6RlВڃXeNLȒ4L*Y$/pp̒9Y}E$%@gh0&2%%"I%Ud(lwp8dBH cLڊĈSV&y8I2$QN<޻QGkPQTڪ&Mᤛ!I% 0RC#1d0aJ BB1#,A7̪<~Q) I "1(helJ!:1 fvpa4:l-ÊSKe mp1M@$B iLH[E Hdl1@m:B07ȠCtbe6١T&Hɖe(S![91Ȕ(b ^P%Ǎːmte)ʒɠ0Fu-{؜iI$5j2Jņ {Sg},RI mVטUnR0}@L Ŋ,(rhi {U fUCl;)]kI""6(u|)Ȩ̉ DmKpC(`op^F2dv(F 4H" gTT ,A(Kr!R41cfmP$ЀHسD X2#赘xֶ m0S Q+W2 V*S]]':b!ASR9\B8N2o~} ?I}t>c|#}IH0U Efm$C0vlC*M  '.W^Qߍ,_6֜_}m*:{v~[D:Z((Rb"( 1X*H VXYZ,9F74JϫI$ժQdEiVk(gݎR,H"(:" 4IiH_Ar-2%*Y.[mVa%."f"`'5V-B4b !FN rH!i&$`JHBD/nRR *1ZL I0 *B KĆj0#Yfn2&j4PuSiXexuJFI0PE`ATā*NZ/BȰ̾7 0U2[F f`71&,f أ (Խ318d.M T&(B)!H$UE$T4[ܲqH=/N`4鄨RYҐ]02e@HA; NE{uIR)e)VrkLJ8UCE2 $IHЅ EMؑZvk*C? i#jReU-ӣ˳Q ԇU9Wܔ ˜N.@\ErPwDTuDu(rQIpQG Ȥs!GD(w:\\ItENT(ADפ:H#vwQRGw~n|RuIȉfBZHj% 띺w#\WNqӔT8IPDGWw$DGB \\GuDN\uuQ I $NƤL jf5EI &dʩ1$*BT+j\}ykkߟOj_呶+c԰w(n fFdA ?[%K ctEР ,Т(ŅDAb@%o TA ژ`VOfRB[rKlbdC#V#|,p8Q E)1\ н'"U²/Z\B* &ΝYY W`E MW%"9Gr5֭xVԱ Hy1ad$TPEg}\HydKAHRDI&e!LY+h*bLʚ ,D5b5@U MI&TXJ s ^Q RRC?G8ftwC&f37ZkX gLS )5R"LC2laj*Љr2(HT(SqB k#kY("u(He L$2HdR$& 15W-Ja ,}fdͫI 3w @N+ʙJ+Cxs6ŨpEVID` bKipF鶕&ڱ k+d1sСUR9nŭ+LƓ"ќQJ/nw5yh-PЬcu,u*_T,U]`": lnRbL!@Dw3MjȄ@Nil&AЗIq6j` 7Drf4䤳.o(ggB KѻRYTIAHM4a}֥䪡"Nw:2$Z%5)O;}(< @F9t@I s8.$9'K"] (B8sIPTw%J"tA@ۥ:. #Ԣ9\:rpPDD\yllnK|J#t8t8\G"u(?o_dgnf>wYio~~=qS; ⸧.#Ӹ;N99IԸ8:ts \u\q\S\PDII;98 : .. DD;J#87Gw#h6a4p)I? ęLi~]}޶+G6u,ūW[cig}=> ݕ^q08(S AƄ2mN0'~W/{W!.^Z-$42C4D`R N.EjJf 0F*iWdd2l 㻎\9"w9m(#Q_Dl-F t!h*,  2߇!:z{2lhR0 @!bm_o((%mk+Lӧ;;,7yFVئZp^]h[tqbIl[mXff3;_noXxvߓv/);;53 nVd4];+c_7~ DoMcV6GCdA!JȦeQ7.(%2%I$$ *l#11°fw90Ӛ^J`eeK],>#NpZ birfm!YB^]kgV$.6[ xu!tQM4t]F~}]vLCn¸g&I"laa"L)& Kj]T- dɄ`X dε|85t wI=8HIH/mfB":C+k{LB='|ʌ "6ڸP`%Ƣa* <+Qߞj2HMD"DV!fJujt(kEѺ7P8̒hbiVBZd,0FJF6ͬ,ɰUD\\x%1Id.Ir\hf̶[R0aRnnmݙOl[n>ھׯޟ>OM z}OyͲtm{ݽ7{׷Oo,gm폗}zBdm^9m;xnqؙ}=c0l{׽Jvmؾ{>}z;{qKstw&mku^wⳎ5{anco;`wx_3In]D7&N޽^yw/o}[,~#|gj]z"l^x:;]aXN{s~Xbnf$jkoo9/(}G4|r޸Oo#L[oC|hiiz=!)EĴ ;MCe觓.e!j{x }uF mwU\^[;ʔ]5w}/b^t<>H^(~v}O]3.jwbrB罅l~_f^^ojqK ʠSKWGJ|qԑsһEUSՠTK 5s|tAQhy*H(2QE1lu:*Ǟ) >cX_wQL1P)r{F9\)ܛ5eO?sn'iJvkoƒνb ;8]YHԾ硽)&VM7EϰUm)v<5f(_fTY@'d<\LLJ0?{eoꨦ~D龶$aX.l;Q9.|#V}KMEMcOj1;K~>fy__ɷg7;Mo=u{ΑX%x@\̨˴|tiK_E,h6砩M^q_& _s4&ۄ\NW9SX'{3SkY?r0;F$#ׯ5Nr(ɥ^ z=Fq,8Δ39Ucm0m+(Q^KV%D-K|R>yYk{M-=ns~׍o@Zq9εKw(@єT\Zg6VLPuwzv|'CJ̀oѡij]-1µ$lHao:y5rlڕ(ʿ(fvYĥB.L( ?(IT?e 2E&wH~@yK,RX/ ߮0 8(zv4P :$*}O&$BH!_OٓM\·hk|#6)uY~O"urĸqfq>@v~X~P~6[<lC,P:$ݢ.QSv:w"h6{E FO%:ܔP`N GNxRJs,ې70LzôƩZl jDÿHgp`JO]H)z99d>V'"`~m.kX[נa5)1M EL;%4"W L2%$?x'W)U+r(x|dR)!XM& lkb8ms} ?-.U#:KB+=*  u^d1')D4DG۰( tYj^;,n)B*;zsMVhH8ADJV`&*c@܉5SQE+ʣ=pQ+'@x@He»\|c<_C叇~OTehjU6gI*"=]zZ7T7ZFv0GS?8p2rۃ _a!6yY k XzdN4|<ٴ4u4) 5_\>d}sTmu_#yzM`A:ǒ<9tN% w5U \.햗ԝVX_neSro1ߙf{#ap*A6"%+4ÃF6|V.l. RpKaG%9 \zcXkۼo$CEVMf@^dj}2U:3GVTQ-D_i {&#ԤYCfܚ󲺕5BreW4­ơPp$Z|*Gkun ]clS@0u3>Qhemj7Gi*"lxj0{ꟊ`ٯxNDA4W$ڷ9d\*RB~ }}&C`P ",CPiUա>!\֔mtP GCoE MoHxOL4H,"`h8Kr=2]goLXL 4z[K.Ivg:7)D}ƻ<.|_Gk޽N~f.;⪢S? ) KgM7g1W[c՟ 1gJ>4սįd-좪 QWܬ 1-=|q|<)P}YF}AUska3'o:-2ﲥyM.S:Qzά.kKn.þswy{S fSSߒ"(c?`|KB<"A6oHW#xtt8G{y߯7aĪZ>TJ"!ݰ,MNv0~O1.7(y\{ƈY(w(L ڑj )[rpYsZ9W%DZ[*` 7N;0ZZmOxł2wT*&>ٛzʗ}= JxRS2$q*n:#;:{`q~՜_cec|M]r7tz|-Sq( @H)4Oui8D#m2՞9HdaR:l&փQ'u˼i%&qϟE:L"ص8_/5y ,~{ަhfDgM|iF5U=}{/9q;jL5}=WԔ, jm6U*IOXL7c:.;:mY zb+YOx`cw\fG9R}Suvkmu(4rԌQߝ~3\jzmof3c:LJguz{-]}a=qm;\ܥy0a<=-$J 1^.y7bs}hf>F򇇍>Np\|/iF|eL[?M|y% gX7߰\6> e Tꊢ"snu0]s=玧#SV-ds)zԶoMQ4G>VO󔺜6=ݡPt*;Y-ޖ'ߗ(f#yR]~߭—zU>VC[F3 nk7-y(i;ƽ&Uؖju|.$x7*C\j9dz%=:}'\j6G 93}K_3%-]3p6ϒ6y}W@g݋-V9K~ ;nlwR !/m)kR0peܺxmo{N᝶à^eG|4ڵԑDtuLjY{ITo}U2YK=]Wdf|]dzxacX|WZ˽gt~tY ~z٢v9~w f~9vuuZ[%FƊS#Z1AGSKd0H)*?m i!ͳ(Bxc^#S__E-؂2OϞ},Φl;I OB*WͿĠD߿)0lܳ3̳}zLmɟH٥|ʔۦ qb7Εlo7lvSc`\Yh?YZ)Ioe{|;_2 >#yѹ18q!͕<0M޸)J>C-+jL_7oeS]5R/}ޖJ%y!$f6 &y7LNm&*]+7ci}.]);L؃~_$-y=Xgu2뽚n+<]Bq|Ɵ>us{huYR)N`@W$?Kgd{,,m+>v^”eNHj̖r_q?k w'>f)&\ Yx3Y晛<͖W͍l7vF7OmNe9-H0vlޙ{?l[RkLs>-K/m8xa/8D5^m'IwGS ^guv]\w/\?y*F7]ai({fY}lTz?t/GuYRIqfXZ5;i+Sa+ЎEUhee.DSfj}z?;_jwf<<pA7~v8N+c6!4|7/T<u_zSz>}}gzV{ A_k.1CE:W\m<*pk1 һՎ^ Y~ZC{OVNTּ[U|W<9?RL5s Ɇخʹ q9lt}E*Kڜ_a<@h6חI2[c׺.y5vRs ؘqT-]9eHآИ4=K |UU}M:t:rHT\C81Ka+Bi[[daC_\al9gsHYa*0$mr{ i8o m"ϛW+d h[EL*Q4@C[<λ6-IS&EPo_>S`wc]P*-ؔY}6ݖ,)#\lA|wbMI9PNGY+nf='P; !*C4\3XI9}ԬQ+EY͞JzlR]6M G[7ab*/jI :R R FBc'7FC9k.h  B(W78A^;\LQʡB7lt>'?j/ݬu=zwup;H쪲'3cQ{y'ViCLibh ^}8pl:,KR5{/Oht}ڻeF9"$q9Lp@$o:@C^_>kW3RA q]wu-睶RwAܽEh]y8n̨wb## "1{k &:2*&U|y}HG mydXu1 <5KLdmΗʒ{v[X/n%M,߰Nf6?1obAoqpDПuuN";o>O/ru $o= cITbe~ln X:Ѧ<,zxv3 x&f́@ ɢa9Ok:R~ 7,ڵkM@?PҏH%7.uR5Ҹ?R'uN@J0ox@q ~f13$6XGC@  »,{hU'񇩗 t >p4ZQS"w% &S9!$ Wqƃ_wӸHX=h15{+$G6l}Ql1 +YTB 2AëMxn--5'I@{B?2pg[\+o U̧N4.^s=Krr4pl"g<𱍕hLc蓾yHk Ӽ(_0yL.9㮃eDOѢP]\uFk.U)Џʁ3B2HEq˂ Y 5)ݼ'%/Cɹ|cD+anh?e鍿OWߘM\<fR0uӤe0eH`!}R0xlIgH.|& 3P@VOv_$HBk~@FB!'L8 @@[uvȘ0 }IUwF~o}2{lJf|quϚ82[iw;=-K] d%2更BY IJ`A` I)>S:VHz`@TfI=HH~&@ڐ!'k@ LCP$`İ$ 0I%z4'`ڒIء2>{]Ob _q[5B2TicgoK7ȋf($u$aYŸ0 K@o ԬMBO,`22 burVor;>^9ŐGĩ i )YB _ut}M+>DL-[#XѪXzt?[\X[ jKRɁsuT4!/VXU&p} %~j;aA]υG 9 `u-{ &y4=[?|Wu'>U? Ekc7)d.CswvO#xHXP}@ߕNßѣ4&ǓCIfF*pp )Zl1}P & 7ߊ_w.c];9Ayb9_`Rfub= TgN(P>"O[qjY[` 8Yoƫ`"4=X*6Px1_mn .ֱ_3H$vlMqUaLW7YۺyVsƐI$\W4amvncdFg8jX*F[{Zwv|!qxSsDD‰ߏB=jVI[$f}{8uvb*Ͽ~oWW@?rf2d s0}"txMZMIWa"Mף=3..GM<71zXD=ʴ zLڏk2Mki iiܩI!:DfK—wW2&$;f̓!r7[qL|Ȉ~5*eZF|:{\`QO!kO~/̳%6DqTo d[/1b!BTf=5|m9x]ӺTۣ9ɉWN>LL&Ļ79ML%ƕ7p:0( *64ʘUËX+GY2ayxʒLWE*\8̥eMBa[K R峡N1mO׀?ggSV9LqWKڦފ>ڒ~L)vI(QgDi0''bsl. x{D3+ ?qFOkзz%:ݻ\ʼ\UNQ"t;'?ym^c:3.jXaqFRO1h. ~hȨ"Oun5\q^QyMI}5f0)u;;.[0zpo*6q^rփD%B9rs:frDw~rLAQ`boTx2 08$,Y6@@ڃ@Phcu!B6R!x"sߨr4Qax"b[9_OU8 ۩;do9C^ lV5URB0&S&GrmEw*5D9K*3I"V L'KT,>vEkGD v3JT _a8 pе :Rv'4'^_oMhO:Mۼ4GrtؗâC9}I45;_c;EۍS/؃ITHK(̒jAB {{TH0)*Ѽ+a&K%.~Ml&!!3RAHE%{H7Ё>-MYPm,L jt%g{V}A`7f,RgF eTq! d! "! џ#Z#f 澶a][YYSDŽLBcb朂bTc׺JJO%\dɒy}r)} @U0U %63Suh'IT® Qba,q}}q Bg|𡘝Du#b.6q$Z[{FE崴B"Hf?R `8_[/u~i*d Mvc  [A% -33R ( cO^<KqH rgR)o)Tzݤ:*] Qw~AQ9Wb"#Y g1ӘZo?O~㋤5{#'(5zn=({!>r@߷<칎gM2Vg0)D 2;V% fBL"̐,Y,RY$ d@VY! 0Pt+` eQYYt뻳 FCXJQ@ Lw 00s:{ nf[횃ok'ؚ $ɔ/BQ@B'bVK1QWdhw]6\nC /d,VI'ݩQdԻsCCw** `лb묺R;단.㫋ʫtʻ$$HYd"H L$XBF0 dY]tWv]q]\,`AI$ \(ABJ`Add I,% H@aI d ATv$DH DH ,$D CBP3!pC%@`*Dc ,!@rHRH")@e L$$1PKN %):HMzWRAu_곊$%$B]e 7cA, $ āHE$(QI ,JDg;s^/{ t=G;!T4 H2H$$04(ItXթd!9۠`$g6#zQ4"03M`0$+5\+߯@Dga@#uj(Ȁߊ@w|Zj8,PCΧApĤ!Tw.SN?/-DAnGq$:#QԶRDF> C}栀ݭ"`O#}Y8 [ EX(:{a_c{ Mş| ܱK"vmjn"ii! 0^w?R^FhmV3Ù Kp8Ƽ¹NOctcȡW;F) i|J0C %PfpEo8 )M6{{<8y^!0V(`-wg's@e!#3Dž՗̃%%`E{_$ߔ'./(C|d mdZxP0-[f/)!YIN;J0!G_łlL0OzfЈ[U \ UÉ. }hw6URlOCضGXq@hY5iz g74>:CmEBHslXYrG NgI\+܄e$6BV olU]Xg9[Km><蓰Naq>(3a_1V4Qj+'~ rzSJKY8aBƿQ*kR$KngK .1$Q/5ĵ-j]ӤZ|LJmI`3Ѿr5!q 8QZYΘJʻ'aSM3^aG:5?A^#yK8d5hP 5=Q?ӷ͋zSmN< ebOCf2cѾS=L2@ -; (RDS᪐c{1 OM}, 2,ze!0#]I:`uD bbWeM.mGM69<17es1ռ6̘wT\,{8;s@i8N(ճ`qaAdHGPeR2N-0L[(T4%B]V_ BgQF:g0|^Eni뽎L4ݪ»o/A'hA7[8n#%2L@ߨHO=bkD UsWc4 F2&n-OjB+χ-V;ſ_q{IGՠ]),gH]%7彸Q^i"x,:|8a3Z?95>/qᠹMe As2LIH'E~xqKV)1xkVѠz#vqQ͕VrMjkс7O gP {򱂳\IVWGuT!>Oxun2>?r)"df| p Aِ\VT%o_DU8\zI69Bu//wIJ?%mKqmESW-aoTwOS]h0qZEyo|ϣoҗh/!i n`RAI/y=sHo"ph.rD-^{]ćIgqI_E-ftbQdZl~kk,ͤ>@}컦KWu=ĐH<<>kTX7}cE0( OmXquJwdq:W-@k|ϗ<+~(uڛy)ϡo0&=&z9 0nh!ꎹ:+5N{ND) `3iX}WN#}|MOC'mP=!z{P 0䴀yԙV3΄)C55ђN!١\vlr`el<Ŧ7س;&c&ee ~9FL8ҧgg?tl*r 3Xr6'cPqo9/?Ա𶖁rKNZ~;lOmC_ttvcϨcí![;/kP8~?埢IŤqU>h(]п3 je8jzh/w_FӺa3虢̬QR@Y7^Ʒb}ι~:f*hIgQy[҉;ל{&vI$7d5$L39{=Mk%ZtQ9:nǤJ6=  4 yGHH5o,I{Ot[ɟ( ,U*g[eHUП1wOga$I ]I&1GKhk]w~n9!S=4N5Aӛtive_iaaiėCf4bK []h({c$z?jq8>$^v LqI4wBNI?x~ j `w!ώkˣ.7x3nC&ͦ{|i)c [;67gt_^d.f/UtޛЀ ᇽI7IX0筛׆x=q.JpVޟ~gWcz0']xU靿=xF@GiA&ޓWA>v_9K!؈&IS# e (=?M]ε)V8/? 3Lp 0[ g{jݞwy?_x?eg?)F5Gh&G uCKG#eLNstV\6b3N6O'TITZXV }| 4fP7|LבmެhWG[VokCxwH;#@PT@6D.84)i#JEQCĈB\BZY!"KemrG⯿ qR5щf7)  F  .X Fu'xݓ{t-oN=3z1W vr@Py0,%b yoY<;VϢ ]̲a ˴ / qL˥1nh!)Â}|ʓ4ޢznaE\GнN 32j_ Y CaH 75Tf);rvߑf1uP6·VHˬ$~G ' H r1_~mʁCa]BcLKPEMI]湽zugkIh>[Q׃_ C yy,V03 Wq=0[xQC^8-Y=^68Q>Ж$A0$N1sEBqdH"R$JTbNr=.~`$L]/=!l%k&m:"I<-00ʢt'>K l=6?{hYb IDFYHpN@ <~Lb (h70&M.,s4/z6ë`oIШCMGSmt'Ab-gmjnZ׶~ҡwsxHsN-TBd}0Z4ȓu>kGVe\a j:\3^\Ca{CexuCu:+$r"0q"!<&qlR[Ʒ<נHH 6L2OƏ[#2n1:ϸjX%1QoKqz3*/tHZ -}#^K)@޲F "Ydq m,"`f\%}4*sK )>5kJ"NNHOCPrD?ryt UsC#J L,$gasUDR@ChgCAXצy ~pYޔ)ΥiB8-Qtf)Gq}U[n"<-l̈́rTĜjÊ4&ųUP;p9M"0&)eDs+c"U1 ދ_Ӱ(إ8ʂ!rh+Y'),NmMn_ȪM?/ Av(TOq HQ,VrASkW/nlYb;IdojV]gT|OXi>aᶋV7$Oл=EH5G3`35_0! 6-zlb2ϢH0vﷂ"Eh G'oio$5O@;uI$,6FqB:&v it/C'I_cgT(0Db׸|<==[S׸ J@tin` 0G3:ߊyC&ɖOr鷸F0ߥ^.3Y$ay/={DXD<7*3sP#!rn r+U!nܶ^g)~wif5 k*"KiqoA+.+ nG&ls9w/qvCƦE:=3%-S$d1H/WBY)CpßrM+)cҜQSIUL)DU'޺Wi2Hh5PY~kʈ>W0AӦpY t?ΝC8N"@\ةr7f7Ud.HoAGtFxMhrHAQ@{6ƒ8@ iƌ@xҠ%aJQʙNLT~6ϩHwʣ؉1ґ֘II/xD#iI'2Zwi q4~/ַ( G.uV]6_@u~MSp 1aC{bl(:_uUed{ZHx{LxI`т @b!0'*tM|b"Fj5b<&jL!+|f0P rhy T ?9ANs;WGY$fݽU5 $7+Ӯz{ÁLְ  :ou&TEě.۬t/фҥ⭴^Z߮C|ӆJPO覂&*T7{&kc[xmL)8Zwcaz3}[@[9c=+j}/v2Iʅ0,VS'kvu 6I6tkЁHlt*Ll+A'~nW?OyoyzLlW<@/}pP1LlyaWxj( @!'RX ͠HIY.EȄח.0T@!8}tt]޷WEϘ&&vr{Ov=rNŅaDPyoRcਛ,CP8J tB{⸏1|'V_yfb@aʄfa?c:(@akD5ʱi)Tt擛YE$-Nq/#LzpsxE3N~g<6LW'ܳ mV_#o? ,Nɬd;?QI Ei{OFF_"k~ jݝ}]~ȯ-mߍOţ7bq~\=Ǔkk?#W;t l |NbŖHGF?gg ^gx d*}- YX[OklE`$]7|rG[,TQ ^?x|_jp^9"gomYlOc@@Eʔ(YYAd[SZ_-[ iE޹nCM&*0ސ -Iq8]B@ 54 ;T (ǀe0Cۀv5A0BD#'*(źr߇PA`㡍H/C'X`,p801y2ڄb~׼HC.~&MIJ#5XUZ3 OW?k1'æW(PFiҞx6'(<8)Edh0!^MŽ0|9V츭dHTPHb2^Œs^^aPĜ1_A(̖.FBDJ}Wsll=E?[+?g_6^z|HH{[ZU./y,]cunN)'ZINxnKӃ}r?gd$GWgDvQ ~מȜ魔C1u޾t6kmbS1iEg8\,u%ĶRYDDcQKWHAj*0]=UE1@-mv^A7KCHȡuU26CB3B\%ӣZˀ?EkЖ=i_ޡoO AQW-l$xP9Tv,'Ql^}Jn*A KDB1!7qĽ1CeLԪT*u q1tJU' ݧf8 ZGtQ&T 'ʮ@1̗.As6D>gXxIS(D>m/xB> RHҐ4mĺ\v%Pvqn(k84rZ zϡ` P"̪I?'mOĶ9|hqs}.nb]DqjMdC  pT!m N/0Ct֞ch)˝ ߰ڣ^j5j1Zie&mC^ͲY|v:Qdz]|eRȈ8 { )dWspTyd'ga L Âg??뽱įK hE)FE;왒':E7cFq2*"Z^ɲ˶?KwǴ},/e#ٿnwZ?jKUVr1ecWpx>] 4Lҋ+RDs12xZL?N.@u~5R~gId Mֺw<\`0Xv5E=Zhqr}r>w!Ch$!CE !ΠqÈbpyZ$.'#5Ǭ)8i0PKW/aGqʟ+`!vpL,$%$I@ $Y !I_{|D!2$70q49>;0~f$Y~Or&/ (?`{ !c#6'S9|.>őoO~ºCWv /77f-Kբ2J7%<cY5%ůyW'$ ϢPC!b !p` 8g'iG}{yN ƀF!BqMfVV `-i~/Ϙ{8Jzl[kp]͝KFs]c3^t%vPmue>K\VsɮėQsl=$܋`l}6Gr3_ǭj Pxz\|{Of}adqaP@2II !HIsQ2NOߗȝOu%"y-LC..{ FF9$,Bz[BQѧX*JJ%ni*})D0ia\Cz9άBo-=h(i84hS˓WS<nM=kbg$ws%8'N9C߽BP"e& Q-wt{/m?싈t"$`AIj$2 UDL{>òf RPE-BD9&?w,=Ip?] vZ]?D9δ =} o˟6v~ϸI%~:\{}Ł=sfKbT?ElۥSa߯ vwA9\Jb0qxzq} Dw#1ԣGnQHAXuVFvSKBtIz:+ 1@^6s64p;++WH)ZV) 4؎зd fx$9Qڑx-D( ex_;۰PJbm̒f(s\Ghu?_p(e›uK'uG ç֓ñ˸*0o@mf |̝&VcBtK j>2vr`6䂦竈\T 21!(Ѿu&xt߷{ͷ.g$"!}ufQ 0g}ĎD=/7ɥ-Nd*Kz!Qj F~}/TE |> ~M GbrUEI_~nNOzo77{vu>0 JKKߤ$8u @"Y6[m]g6MJC0!}͐@0@7~g_0. wtJS8HEq~d^}D>zU!3_w:*k\K_x3Ύ9KIuV)LB 70#O65s&76&߆tDk׳xm7_V^cLMQbSHO4=hOKes1t,C+T2|ڕoRqwQtEq(uGIrKuݹRc@e RA0cS_ﻼH.;fj nd(~' شH('Oj:,23PbK*'Ze0f>jXA"s5]P; 0>lXdX#HSJͫZr-v7ᣘ\]4W˩LuJAAAY}2FD^}$xxbZby/8ŚSdӐ1&7#zs4j҇c֬9 [g{zk̉Xw"mX?nޅjrm0p}=@`ܯ!Ou똂 ÀLeUjv{`ͷOG;Gw?ڙrXMǭ#u>o4g[AL~͆5eCz|3;}{o'}h>J14`5u|EE#0! }.+srO\9{]k5P>uBB;z-!J϶'a0aBBHfr0 x ?;e>&-,ĜϹhh&倰L={ s%2Dd'| !?q&C0#UI!EdQ(q*B*oA_=j7力D z2!ߤë;T2JhԡupOpv;O,y12r!I8!IDtĔEG&;\,fo|g}}fK:`vRR6/>Qmo'Ni8C4J z,G>壓r x^)-f1oD0]K04;Q^{'U STEV2j[B+g=ݻ֏Lסoi}?_<ȝ¢4ٗW/,VV՟cCUa꿽g 6SBek7dF-ƍŁ<| 0MPHv-&xNlNSnhwo}Ek?23&1;~fV@L9,w}~g\G;l=_Gz퉭2`jII I Q$"@,zm:M];`0G6;=d`gghZ#:?W8h = {ԴX`kj|̥n[7 wA> #!amaC# |ŗ˺htw(:Icv&a%)D^3꽉Z`hfuIit u-%'2&3:sXV:Y{+11PA\[uorXv{>OpQR:F&'*݂z'fwj1K{k\a餏k#W4dl7^vަhrpb=M]{*KHǟvMYQ]7S'g7Y(LϩE']q $_AQbg(߮+cXu>m+_VSb n[,b_|Z(,[j*,RP5sz|^?}~.ן'1|;* jG> ٘"H$wwv3ڿeytx]h;{-؟l^#.߿(Π/ɿ3~b/*AbK.mP%r˗`xgz~O/)ts̴K7KZ*Z {{SkjKF҆f?eu1G~Y*֪SѰX稨8>-?cFLuHZŵZt҇żu P f]\hj;?"In]"s6(sŪ0<Ĉ *e#3|mM28*Z15Pv34'3 h7wB H۽0bڽۖroY^cœ~#&W;o4v͡HjuM72bs{Yd̿jq4vb3j%00%BcZz_*6v=&|~=@$ zd|vm,6?]ٻF{F̚P\=@֩p8!0dP q`l']:MDΡ;{Euk9~K$/K.0;0 N"zK,H(OE f $%̄ $Н>LRq}HK0 \=cu Bd&8U%!o!lX! !+D6NHC\d#%Ԫ(r;M~W"P&Y"D &bCۢI0H{V >h=/3__Ƃɏ+w<'NdP^g;CWos"NRCC~{Dw#|w?O;v&$U5 yb#;f#` fU U2 4-pԴ`=s4;}RgdS@ d 0ܡhj"ʂK@;*Uӿug^DN9]N },hjT 큀E LI@""e,ÉoOpQ3_̈́`cah[b_1SAҴ?qCu7H,7{Kď!]FZ$I >S&ߋ>z%!Jin:Ép޾kq.=G̙> ㌸[N.{F~g>=0@bȍ7?ՋE r/^xDq("`~P >aT|~⏧%s0 tL@D6D?.'T̴2UXMᛞf+Ǥm94*V}fIN}jrx?+lQm/zu9?NXfn#<7~|/v%UzDZCuʣPHZ'7ii _*y.7f#{Zn!%fj}Nߡdԡ{Zl=egmߍq*Vq\gS> #g BK ZAx f'lWUDV*HD _1^Wt@(;JH+o*!\wk;aoz7ջ=|NIt=#f=UX*\`&RMTE)n$$JNҗE=]twWNmidwjs::DXQIZ"'?S?'IWg&_yZMFoZGoA,~ y9[=by>3jնi9./YgR{mdk6:-, . s|\=;v+`NwgOe*j ¹+[?wgr R _oʒoY'wtvtRotd$"hL*OW|_cz_)W]Ou{m3'=7~Y&ͫ@ !L'I:PU?IJywEq:*O=8!&_,/y_evhNG6d5V,s&HO=f[=6߻vm̨Q|^~{cԟ4Y;~oDᄁ!@0@)CtyaxPtc.inv/5Kzs[=o"ޝgspoGPHwLS36}E-ҥ_)jaבxESsk>?5&I-$ric.wm1d[vS|b~{O@f7^4V\?wt~~z:ՎI~{Ffޔ)qBp Hkoׂp 'V+ l!߂L nrSzZ=/ A7-v:E/,_E_xo.c:ؐMX1>~CIOSmVc{͇º;^~ߞ 8^ƒ] /0?'d٧Cģ@~ y*ob:cduv^e>k|5tLHӂϓ>_7_|xILXdfV_v#d~7mEPc(9>ţ~B(0*@8dp8$@@!D0s;M{cŠuMV+%>zv-vvGgCRREY*u k|˻"?c{?Sgga5>4?wY$RH,IL%O$$@HR/u\G}Dמ&rYoF$ i!}tуdW_44M3ݜmu4)]qw74J sqOu:h6eRC1ҝ|o<┷sX9S>.imM2o끝W1HŪХDQRBdh+@OK"_sxĂFאt*S,waMeٺqoӅ8C6 Ft\s_I㳗b#ڂރ>4Hr ړ(5=/;_WhHjɞ \|C'Ƭ.H\`_SL9 2gT1(3uvC=/fǗ{p` 4)[J$kb$ C%2C !:>u{d1O$B$~!d:Oa ^ctr씐ԇ8! vK}*6:.-[atz6@ٸBFSGЖ ǜL^gs;B}Ы-VN:" M<~@4q6aE*z6cpV&֖=Cx>iuͼkg>#KR]q>(PsҌ_ͺ¥hD?{_LyXSI(/>?um Z6eJ$:FW:Rɩ @8 AS4;L|NwoοX|?Ԅ+gwb߽bE=:֩?B +lި5Ba'E@VA Hɦ* 9VT+.<0tx&%^[zm|zPʳ;w|FYuRq͇=t^ToxӞ!P/ \v++Gpx>ϰRnUw%XͶzLrru%6ox8QЎ<IuC @E#o<$m;@.a$4q'V!l9.*YL/or?ж#E׳5#.}Ml)|NO.jC6e\_:|avޛ>rI#NŰ(Ha\Ք[S*~ߡ[J>Dkuh/o{gfA#{z s;]&1j ,68؛͆DFyMfsN?$UIr/XJsއ~$XDHQ 0FfxC 2 1ac }gd5w۷g&o-ԑZQu|r>0JGjMGsCj)H)4 r-=;/cc,X`01*a'YzWNδ>}Bȧ3AArH3Œ1<6_?O9O=׉3ngoriqٓ1uR(-TRCu:Rs/wVNN'#нJ]ڝҜ YtI R$g='Ϸpg F{ڇ>}>.M_} wֶe5SrT{}bzxJaA (Ē@BqQ7\ ya.nXlL (N$&9 [OWs.SeۿP/s/=K71+q\9l; X7g)ZJOV6*_/y[?Kbb7|/ + G߹i$V QxC܏.$=XEɀM7׿i'H~O X@ONt$K$l$>J_}o}7g`s=Mw'[aɂa!) HM`@I 4!ByD!~o#}~O g<<=HOLͫ]`Wt>u\t6B&y 'xdc]6+COOKń2N'sT;UmpÍ>l}x&R8((-&ئ!4^o'!_XD2fNH8k؍GdyJEO #~dyfQ'TVS9ή -0謻 ^?6F Mr,,QA`~_q!Ba!fFkOt23R'CUӒSQ.Iz*V(~?տiQ2Hs(H*hS&*we_,wYwgyd.\Ze坕8#}~w CIX7S~BB?P͡<a$@rgZ%@Q)[eC~q^mĂksVfq"oUu|P^\bRC9vYz{97`iP=>E7ɴ+tL7YFga Iz϶ImׄnCC-'x,2H}'8?3+4iuu5sr;6FC9u;>R:5>b'/9ղk|?/ٹٓdQІф 0! aOa$zc},g!Ub?g3@X;Hf9*k[b]{jt|Vd<΢T2+mKm\[uxE}@g#\GܸK\5ލw}mxm/}[׾5JLܪq iTCh>Ѓ9Jeف(H*s n3\쇔2CKVIO6cY!:?ZW}ia#=E8578ph.󡲀+!Us ݗ5>}PsA+a2m zg:om!Oİ(?k.a.|>Ӗ=~adÜ;}11:yE)z$XORABK0I\JcrG] dU_֟oM4DBsl/mD3:xM_ilLi Yhc:7 y?4>|ڱNC8;15i z_Mm].~&'j0l)aV=xէܞ/֌wMF`)LܜSE}OXJy0ѻ=xc"3_?/´!$ v4hX[k2NƦj|=@b@BEF޽ԶH:9<[7g 60~D2P!) <2RXᨫ%mA-]΢󮯯|ˎ+X"$%$gx|o7 P8VoPC2FP2x=X*;9C8g.bv JnerFL|}t*b6[nv&B!ZNhddo`P ։H#0Ȁ0;>BhM;uaS_UϻO-4nV;ƣzo\>{k2\S/Nl`{ɫ9_NoAI;_cCb2Ukm#riE>ag.H2%GqjEw_u_z_Um3I~p=}Len>DJEkQ55Xƞ1uCFLJ[WFO&n5GVwP%Nõt?fb:B(T}r. {N>нK3݆__pvk  @ (`w;-kwt,=fVdW7 % l?e$ä=vo$3oHGT@}e2P,AՐa'U>GuybϾqE60HR Xg@n:o%hWs槎}kQqI~ #B܈\!5b#q٦":TS{?+S N[e ܌F2pi)E/$ E*HdiDF %*  4 M8dB1@O5GKa uRp\ QB#jۼ.y{1]Ԇ> pn'bPhL~פËŒ4UH#֤Pa߯A㍋f eaf(t-+[wر^}n( аB<;1͓(lJ45W \C^T05mG9,,y!w@Qw[r!;qh1A I iFZi;<ھ! Xo3Kx]OCP2,Ȣ 4i @f<Pԋ!l551)em*@BiT@t,!ģi^th'P_KI,tqo-5w:sGzqׅ./;?ֆ>3'%P?壀^/|$O!*N T@XC 9"q B2ÇOPZ?usw!|p6:λW=7riD6zK 0L ݪNמ+*s>vW~;bo1+q1ʥ"#PTa 2 ԉA([DR&&OL2BNJ;O#LyZ_|(d]-4 Z[ך}{XȕڲO;S<vHxV=.Y:3-%mp7arde$٘[|ю4jS<ܩO 3 &<.\ & 69}L_/SӬXܧV& VoukBz$;^M@lVGk6gN "k9U*k&z]eFp"8x Kx?P@3tAonRXP;W֩IrmAI؈-dxz}6+em^ˮJd8tWEgĢZu;P}ۏMT%_Y]`6mqlyQxN=1sRdcr%. HB?  6!e.e n 6cC#48dxC$8B  g-0A{w,YIHjKAU9I~}Ggz}y<'G}~n5$ ` ``%$36Be2,PFDbYH$8IwepTa 8bPxx_nqtXXHKֺeAS DĜW7A90@QfWgK} i[2:UJ {&uhB#e(De  UR*eD+(_wպzTxbs qo{_cL8( ݆[5 =/;!Kw'Y&V8B@!B5wG?uߵx g=\jbv"$ CC \(L7GЧ3 ?x { 잠[@LftmASEwmjW2T-`J]h$DkCӭ󬷼yBĔs֐REaw}pQH!'kSd7ԸK倡";9|~t᮷Dee1ԿS<Syk R1a&i&e(7ΟjK8KS}&_!տs]\Sq08-!'m_?_ Bt9+c>~3.!ch GװJ9gf@l`H&* 6WG?} 6!{ nV^UT;]Ktw8{c>VbY'kVŖSrun%ID2wʩ yneVqJM%Ui^ϫ~/.Hd`}$aU BK}ʏeT=p/#=1ڒ_ .D,al$ڇ6Qʞpj8%Pz&t U1'꾟  :Ezںڝ>y7:U &PȈ4kTb?Qm<q4 Eֹ:DXkQ(a ޾=h ~=${ĤbwSx:"y^S^{P0IrA Вm@~N‚{?[< rNLp"KP~<[K1:P9"ŝm} Sfo єg^٫r__E߿XGjߕ앗|ԃ  cv<<ؗ_ϱZ]twp&4ݒ1Gl7Uf5.Z y4/y%4~._r@, `?5("Hhym*sEXbƴfu6>l6ATBu}%٠ ]o՜uR!0!\/n8\=6Oեk35H DkVq,hp_? GčC)9h00x6X&QtrOʫrMD6A 37Ǚ"Oj F:,#u`%w L~/UQA[AEl<0$Wxd *γ 1 Ip)0 M%s&ڝbc21|3/Zy6^!g '<̺n\a C־^哂-I %!A BDH|G%֓-J}w_S4xx=ެ u&$TCu6ݴ%kÀ\ tO*L}Kz6vNuWZgu N.] """!8!YU)FTW¶Kޜ"U-6H _K9ku]Yz眔*>6ì A a9.C+nTF `ևH,g𠖝ft+N?e0W`:7 >&r'iSl(86QkukQE({ԲIK!JdY [.dV!d%ジ,(T)?pۼ噞M{&_//D*6iεwT&ӒLp AB`kpަ8;l5Vz'aNѹ@ F@+AM:J0X0 B'vڽ<`HܠfS2X6ߨܤ, 1I->;BkM3<9_Ol[f"aswMYSD Uid$NΕt KULeJf1x>;VE(uj;w%C_R/KREв\3%apl3]eF]fUv̴I"d 7@@lWS7sꈪ=D.Տ8+XPAu_BbCˆfi;xx^(`g/#dTse%3v3h^t%⢙tK;Ғ.~EN5x) tgSlaNsknvecBҚaN 0)2" w~/7y~+4~;漾: v^U>s5(@EsA+٦A]$C%Rse,f1޹[mǫ:Q1>%R1 ׸B*5-kBJS( w\~Eڅf 'C}/[:LZʳm*#DudZ3LW򜅊"?6ZʼяsÉj+px6 W2|(C%͞yakQ $|@@8{I:UidM Md`4QBZN4QPF^Sf𹩹o%\}"HG;<{]cXkRC`B80O~]"Ll`4#`bi9~IG r?pU i|ׁSKÅمB0cr[ Z ѷX` m tvQl3L!]!vS P0ڶ5$Od밷 (<j ~e.f;nSOyqn'LU~4;wyW\]ו.VVuN+VR CWպ=e3&@ Q(FH WU!T^\{Cʎk5Cqggu2NUyw /eǐI:l:lP1 ԴNҰ .Fj$ ;(GA1$ 63uCu)/zNF @dH@^&!:1UIR+̣JnGyi|+Mkl 4$ՏolC{;K9 YF..u@O|?{&q! gM)!ֿЗlx oַs۶o;ߋg8a5356 Uʤ $ᓘ*3InZYYbTV@YJ@0-@c)tZ#:aJVY, qϑŀ=erx^乥!93{. `8&P䉊ytd;S"$nYcQn5\YʞPCWE6ul!/"AݯzcowwJr0aLzTz.  )Aֈx0&46iI=?S4{Okcv_s;z S-t,iݣВ6fjR\`9 T8n36|dh+Wq7eLJ^{$t1L]WE`lfDZD# Aa!XmOhk} _@+[ OXA@&V7OQLsLH0`H +mU _K3$\JgWxkpdNoYLw[coIlF:^ F'7RhG >ݨȒEkϒLG[;u(}>Ɨny~@ nHŋ\ZX GV8zBnSw.2Bahx-3\s@bY#$,na0aA,;0B.kO3^Uk^69n6\Xk^27T+}L1[,1}E$Qj9Le  *8`րw `G RjjFa٨4K9&4@?ŊGE1p\uȖ/Tb@ ok.9F'9p1Jn_"DYJyfS!FoħiM!61 zqNt>$Nc0{;~ܭ̪OFOgu1V/ֳ9 3݄->9 1STkz;N qi`v%'`Ńu =o5 ;].kfQ :?v^[6'3I~I۫$7$ Z'=!*' i,BG]+YA2E\ \8j":&UnBJ r8땛#\&s ,q)X>]ܮo)l$.8ݞe`d=}7Rw/ tn"rI2k/TN:* n򴅛DP|y&Oz-=^2jX8pQ<ۚTPwA0AM w7٪!RuʟVКb%37r"6ή'DQ _ `5h lLH 3GL3hZUձٛo:nȴF!wJlA@:L+҇W~>GV,-t%$2'bQknTcH̫^,94qտЇ>I[ фh 4,2N@J>p@"FW4';<g=+,cQ*QCx/Cv)윪].: b{P@!spEG{n{Ӛ?&?8y߻NG!6쏡liWP" " X4IK$a4tÖնfSrk{P5~5SU*mmb a.feVIdwISS^)+|wâ wxDT5yߟ7JM"' DT!덁Ms1hM&jIySЂlOh|ըXQI]_Z,rp"h|WseswȻ8^*mcEiht?. O vP0@0-19[cLEOMɽnѫ3C X%7 @aA4X'{w0SXs_qw!u&ka„nQylKϟ3  8{)&m&QO&@HG/"ˣf-Wb8:AoO|?e4 qP{z]VM]4H/rM-̊ c. )[yfsw+5y?{,D$#AhG)o0rDLy)7)u@;vo켏O[ 3],~asQI&s 2Ag^k%ޯ.uA+^)M5T %0"~SfVon^c/pyd;dAd:RKŦbspi}KӋQ湬doOJB hP v4-:f>uzHEV`!Z#\~+MQ/8" m@Yijqn'QW)ާsFSq_9@W 3VԊ2b=>@DΔl^40d'sl:_Umdj}߹OɌH(ic,^F+о|b#Kq>xBzQP6 /EUNlwCۡgiCz Le]K B xavh4DFblmi-~%l8sC8grD͢U2jLFcNԖٶd?ߢ`6$=CtB:49g\iXRDèz_YXaGev _oQ]t&/^wwĥR|Bkii^f{3/OߍuRdo,G9>ޙLR)' T1CUukVmxL.j}Xw%&*}ޚ$?n쮁ҳޜ Mkb&F!Bp$@un#: uV[ݪMZR"D6 FpOL'[& , Q&ϙ2wAgxn,UzfET ʐnW|C}R^=@xФ3K`ynBz 'u@@2iuh5ɯ{o=]r/K߁VoXjNYQp-6|L-Z/#3u|Z8M]h3 p7Boչ@> 2T(8@ 'GAR ,?HCD8Z0Kk)+c*Όsw]M 9Hlb֡g9e.|rSiS%Zk}|>os'fq؄`73玑"~;iͦ6uUSOm6$mYOS4=gt3(Q0<`wfL#xFەNFء=ۂi" H/ A6r(ѵ>OwEfAZ_yzYu5o6T7]er\>?R-:'fyp|FeCM(\Rj@&0@P^ g}/[_S8b奉lWdňA([K+#j|N߉cd\< x菪$̳GƤm76N6j$SOߩ#)ucT ^R 'N8~$WzIdT-9v^w-?t$;VBd'CN;E |FoF:6HޤCl8mJ]Ws|$3 ^Oޓ|p܇ o[,e|osȞ[!ٝZӔuu(~#V 4)\ja08&$!$pH?ѓ)uK  `2<|.Q& UM@&A d JIs l0G:bE))E~vo;w;KE[n}-S_kf47WTUk5 -TB[ߢ}B;vDjR l"YḤZ kMKAG+fV&{ 30pE=`ؠ +GAfN qͳ'9wr/Z &5Z#'}1QmmHF?܆Zm0>F. V`^/~Ñqʼnp(FYH?T"cntGB9dk>ǑHH0KTF-ִ¨B*ł2IQ$z )Qֺϝ'\?2d*L-DSCQJBJ*j87{%]i=ML?z=Yd!d4JZ}Kݾ=/[*3lߙi0LdGt'OUTq>ŲZYUGl_ }]!$h9uv2ҪV=4( 6 ];Ȏ L7J,}wRp X&[=n&Ay 6nǻp QTH-G-"DXx%11UZ9ܸu8 n ,#qL4iEP@\fx)f!ژi @>kGBʋ$CGίЦLg *_ [M7á>p`vd`޾T!~ I;%|ax)J> S /׸S=ٺ"@UP{f$~0}jA@i0pq{&pHgiʩZ0y>S'`ǰ0`^1EMG~׵O,[b$ B}V(۬Inm5\sZ@i8NK&LCh-[g zrb+ujp@)#SwW8zyYBβΔKIkPyH(H.nWɓ/m35bm Ag#m7F!RR!Li餐$vXzc1s QP226Egc?"P7@1as$+~ U/JhY Bŋ.0Jr\~64lܪ",K[a%$撄u!iާ6O?[B1ۥ-FhYk5"PglwQx 94 &nx rof&,S&H $G tR{ G%A}=hiFͪX[g^^vd|M^QP몫Ul5^ΒEckbRmX554=ӽScwXG@Z#xiNd~|~$EUmkCzHʼnXF8kRZvBsyR.m QqihwRsQsiQqHn0lQ2Bj Cƨ\p*MMJA#0:bFdnq`Aέ&ă㣥SuL.,3sJ4OKeؽ$}#m{ٶ&ڗ co ?6իV2oǤ2;76a$i$T)%e)kΆ]cXB{R'GJy|MĹG$2a&ʰ b`٧ J2+YYW\ܐoaU]8M8 󍾏ܟ*S`rsC p3dr\/sdMmqZOnjӍVqv,yov64\;VZd]*ֵv^'qpէ [--foRF?e1'd$ :)%7^Q NG&etP* 0Фd >!\ezuIY]mrss*vQM*Ry6ގʦcwlFj,Y/4_E+9^,G4r_,e3stG 'J¦ƩC5N-CJCJ%øYC$nr"v&&%B&rq&v**Ъu:p2[Hi5 >p 0Τv5 CK]%Zld‹hf]Zla7UVk)c%oꑲ֡|;g]\8ooyUV{([ٙrdLEx-u uMe@ܥD(g؇s{lwyywC HT@PAG'AH-OK>77Ѿ%^)@M&lYH9Is|Eg)]|#.B̞{̹t8#bUimmOiNiֶ56~>ڍz:I>I*Bu8sp]ӊ.oIo?ۉMI|-}+r]ުjj"i**1:K4$YC÷>C4=kt1/.=-u+1T2ԯ9 FN mmwvDY>=Үg66F=ސK}ú]c%cvcH" oO,20I) qnk`bE:33s5w7Y#Z0ΞuKӀiy>)սqU%%'ε?^8HN;GZ\Aӂkť94.ĸ72HKKK4KK1B7MQK^XMR j1NiuW7Uq)r>64ksWf4|N]WOZVn. TGpvL8\D8ŵ9-S9ֿ;,9QL -;Wx9ȩpS-IecpuKLſ7'?88Fzp3PqDLtK˩X~#^K4;HM𤢭 &"",Vb%eKWݔv~<pElTTd R Ms UKDJU1L/K]e뫫2U w94gDWN3nJ Wh$,hG~R/ѐ{a xRsniQnw( Y{ ߸9t }9wT00BI(8(GcB82qA+(9AL%0WN#2h>G!9SQ'N8w$@ CiX.Fc?SY鈋L,:8ЬK'*$VK+b!j"^|s>,,H}.Ay/uNXTXZlnacknl4Yr?=G e{Q|wp'Aoz4Qp#X^a^X`D.>}A=Mhwiħ0 }R*rVXM4G]PH#]weƕq/8Zaˊ_r!\&>.RRf[KeobaƉ'wqLk\>7[/nVp n*d2U,)mu\<#ɸC{!|߼nG[Lgt}2ԤG ({.Ь)Xڳ2iib4X[Wq.kgSUd62fu,B[,%kRD)J?DY K9) +=b~#C@xXLJ 8U%3$1v=f^^ZRR:-ZMV m"4۽m(]kvyE9wȢVĜbYIlŽψ\L_M9*ꛪwe0m 8t U^Ǝ./;rػK5,6*+F ]$/?*SML̅>EO $LJ;=4LGJԣD޷]8S$ 1a(V%w^8JI/^aCm1NM}fss)l֯PU=RU)^eu+RJc>Jcv:@KG!e"JŚ]6W9*I5}lth鰊˘Ylq$svT9wqy^s0>'}E%>gh/׸I%mP |2]`sY F@Ct-&'/W'Ea4=janKж yW԰Iㄦ=vKLymws 1! nuM!*"i)׊[f@I7ʺwbcI 0b_&= [q[D?B=e߳] f2Avs+H]L)6bʉE)DQ>X$.$prT%F A3Muon,տ8Gjc\25fxfUlgbNjqZǘQ6n)[pr%g0zp]ڠ$&܎u^iK^ Ū &&N"dAOObyz5gArQ| =\q.j:AЫhft}l%Q*JPcEK<Dfy}ZFf;SgAaTSy>vk9]YDż@LY9%sFC.O渆=O~qI'<7M)Gfg"z&їI\}M}]V ҶJ[3<*ګn&vk6ђ/Xy;AZI7#Ո}};|a3y)rPl0قF.SqpE/eR}ΔxzWuƆR7);G?U-/FNTi)^Mon3O6Yh\>lGYkNj]/m{ͪdftӳYy=NթD` 5c@vZmhGMDJ_ɉN">K~rvw[>8[9dnJh^yJ }F#p9o ˬuEs\z sL%&f&&6H&z,y)vYgw9U۾yan%Amf (M4xkvp /d^mu4e4%3-"Dz%z<_=!:\-%:\62TC]l4)2j3)Ul t0͂ 6JWoEQ'h)2W>IDCbLDB 48%k uzPSR0-K@b֥ YIb*&i*Wgk6/d*J$<7~~n .ylaX˜Vb%L]SqtN.1Z#xbe%6I6AkBjQ(eh(h(sL"dхjk%og3s}%kfL~ %+{;\'m* 4鳪r((5x5P[1`:35)ttǨ=JQDFLZAۼvVIPwIUI] lNNv\D:WuYrRJo'Ru-X{{iMj2ZvD|TDJgCYӝğhSxZ).:b]jS+e;ȝe]9uuOAaf7Q3%e&eK35/#LJf/Ro5 ޝr])KOtRW,1M.HxlF>׿YJNWU(((h O)q+\5l+;g1GPt!-G?EɟOa5p,FOD2xqV: GPT_%h'"̩_YghDvLtk{ʄ[X~[˶jl/NB0ß6vw"s:roro99999987NϬ}ԭ,d7'ߔ,d"i* ! ¸S,v:Ժ:v~iz:/'cSTF Mj]o:9KS>ޜ< >/)X}ި} vߊA> m]b`{گY'[xbVSPЯCuY徿!rtu4TZ)zPw\n~ݖ?9o%9~}rJۢ|WWW&wju<LJE_O!;Sݺ Һ;:m7-}S;D? BtaRNYx &e~M#K丯6Bhr;XSV-c.R?Ķi4MƜb**$s,ǪLfgp+z^қn% u~@ɫZ^w0/W/g,jA-$,NNJ*Ohj \VCOL.QqP/˸EV**lo")ٙʖƑD&W%-+.-0L~ޮSg:A*0ptn#ȩ&<#군p[g6 2{>$YMK<~ C;--Xi s;~^*2It [I,͹8gep <.Ͽ'U3tr |#~1rQ6~'ZcK  IIh:)4 8 ~k?})''$#yKlw2ʹ6{Ѳٸ9쥄);::5"b\"FV5zGn/77d;o?3**=اf|F_'mIlRYIHrrfp"vLnjҦnpb1u3ybgZ%EVm+54bNe/_3w?<&%7X<*ݞOK#qF4x^kJ[)FzW?;:崒HI$I$I$I$I$I$I$I$I$I$WI$I$KJI$I$I$_)$I$K$I$I$I$I$K$I$I$I$_x6[I$KԒ_I$I$I%’I$I/I$I$I4I$I$I$_$I$I$_I$I$K$I$II$I$I$IsRI$I$I$I$I$$I.I$I$I$I$ŕ4%$I$I$I$KKmmmmLmmmmmͶmr};mmW33<ږmmm-}@8)EҋԝYJ?ωE0)=3~tYV0a9n}\$uOEXc|, UR=eK%Ĥ,pUe~p OＩ_()~Yoem=l- 'z{7a d\;jjbjZx&y̏OIo/aE![U˟b{SGyTocf(I8`WemutDn]UuYW[~WOd@YA.+4;F2XoN) 4BZt?Pɯhr1(#o4?mO >̣9Wy({^W>)f򖅗Z!ߗ]ݳfyO ^'oH#ɧlU 9Db¥@g N}'hLzQs}Eg=Os0(CTa(TEUdnf)ASvy`X/<:5Mˍ¼1V8C.{kW?(>xzU2} 3*׋-$`$[9u2?æ O-Yoo˾הVwEUe |Ht)_rS_ǯ0 1%f$ɺd(С#?pJC,6l&[%2b-_*DDaC{aҩ\TLo3=kϮGXM*µ4kRmHڽKZt=Opf]Øq NςXFQ֪ɤ ?#)l6M|RANRN%  YUUI J%8yHQ Q&@(Jr{$qS&5zr&MK.,x\,L7/q*A߿}QJR j+eS u5 ) /b1/; `XFBJ=kOV RͰA*z; N̛9`f!$bR9su`@P#8)t.U 5Th.+B=9'n|jWСFBWbHAs 4IS ]"y|`b*T 9T)a*Q$܆G^NOO4`x0ӛ{J^7V~ HnVF6=eǁԹr*H$&ٴmRәCcС&E)TqTl ;4#4h"Qi:{{HzfV9ThRZQ[qq{> P'N*T 0FM۪7"ɼeC%g4Qxgzk%ћz+ɽ۸##藡NQƝE*{Е+UMBc3϶lKVdŦf`l(┡ѠDbNgRpR>Qx$@WHc}]1`ʀJu { lO]ݣWlVι QհዳGpf2ܺŬFN6]@9I-V*("JKz+)fU*J'G<)vt%D2w`ZWHr;@\EξʀZ@0R[ĀGʧ5k5mοc9ڙ>q~ƍ%iMm "P4QTTV`?I-] <0 !t=_~6 lAG;u/cC]yszD:tr~D+#9;nA+ٛbȼ柳$B$ƴ%0stL@Mu^o|i<g"G³*S_;NΨBT75֤Pnؓ:)?Y:HMKkCoYg cC~aݡ6аP;p/-rAGFVh(!ROK[|e~<9>6U̩hejj_Yߟ_ܞ^NNiaU~|xlfbdoU{SH v w~ tݵ<%=? { M탊j{V.fħ}>R*_<)/&jVGgO̽~_x)>~~| 4 ddX.͓ *[HᇇY~:״0i!}{qæx}T,Lǿ)EZ& 1*ᡡP`ܚϝ ߒ,qi\Eⶶ0,d<,+]~BT'!NS7}kuuv.&2f>>}JW/n>Sz5jLhds+tnߥ"׫hl}0Y}ql:ey˰myO<^3rrrrrw_m8u/ pppppJS;&;S¶VLMi----2  FVVVVV'>g]E/eCAr_GRؼܞyuFNIɴAsˌV#&UnEn^"Uށy:Yk~hXXXGH8=$%>y GR_4ȋ ?ɀw; H&VXɽhzTtB'r0ek_yMܒo~|ﾾN$M=0;|:^6@u >=O W7Lh;*/VCOď=Hɣ>d~~~~~??Ow(7[Lx}F?S*95ܹpO Xm&,ANOl/ޛgl9ŕo^Ȼ\S#ްV===𞾟}}~~~~~~~>yoooooo{;y>jQ0Kt?b6Цpu'O;5*5PU:{\m@*!aa~𰰰YA 08RY^mSFqc蓴P9TgȌ8yf)8\'"z'ZDB}ןο+bS k6G2t?[JK%)))){DO… (P]uYF"غ뮼fnI4%Yen#!gA`Dblq`А0n~dddavIp5PhԬKÿ35%(Ctk+80U((((*2АpuaMCCC9ǯ>B\2Bm&Ы3W31AXrz3"} VbA?AAAqop0?L(-' {n5!`{v84UX (!`Tm&NBxXpd~ֶ3CCCCCB¿BB e8ITF<ڸjT(N4O_<+W>;1`!N *MӶqcKTiKz'@}Uuul5h604u/o^;>}'R}QQQQ@U@`iࠠ7rݱ?⼧ sϫf'Wj߼j;%^N;S㇆%5---+Ӵ΢zzxxx4iJn6Tսv ۱*]d_=th$}+ /< wt:GWK++զf3SӶAA~߈'x((x(-DD(o3oPPU>Zǟj_}y}-5KfST[W4mnc=uuwOTlM#9 //ݚ r}V-_]Jվ;|_){S@@+~ )K?R鍯Aq!9Z*c6`^!ݴ$' :21(zD7*b"cYrk[ hxEJx 9s 5`i7֨ f31bn<?DH`r~/_z9!FZr%bUsHPsڜZ{سnФ5S~]Ck3i#We\nNC3Ї1>'4Nn]f~u !:YI@MnLĔF-O&i\ѡ >@P=+e)i)ԃs1NgwdV(md :zzZXڐ+5[ J,+vҤʱEBz4;[DG(ݑq5Yap?E~F~Sg80/VbG^&KUn>3N_k|cڠݓ4r܂.Ҽ'p\4IYEE$N8O!C2H|~ktt!w&v=Q,=g5"4Wu,SOE:" M P8+ܚ~菄w7tBAa:ҏKqt˒fg#dtq&*MPr2(2T*d.Dc'㳢E?Ør%A9v &e[*sZ .'1.PTȚ)I uLf g9DtI뜬lwpYɺ-1{VNYF;:pP-R-utjz%d5Z^1 JY2"A9(EbKkK.RS* i3f`cCblYB<% s&Q L$TbNV%  \~% S}/|*C#0EƔJ,?_#yk#TFHDHb fvΞΚ݋#&2\bu\qu6gu[ fvka b`|t7*)XiY;C}uKX AJ@LxXtL) kjo޷0ڼj{m2yy{o==T0?&_=;'axJijrW^ O0q5Rhv/㵶;:OSD i@<)5 }@=,kF۔IPi:6""+àp9iT#sH+;@ $nuzVCԥT;|&v_y!a. %p!ErK+YyW8B#~nk, [pXF/9\Ռ=]}a ɇ*yyppeMbLu瀯~ taT/&u}y B@'KqMCun=|z>]rv d"Lz+Z{+kbi=/rHc,Ks_Gp{Y( t !c&nvt% $h(N@қ0)Tv}#W$LE+\a#ҷ?sR/ p`*o0F3|:m [f%p^?>=A1ti BDzHXXQCCN<u~:F.G<8kǁjqtdcF_G]U3ٳZ/iu_tlEtpZۤ\ܨ))R& nBl(? `NІ4,TE$8D=} !Iއ3g{J.WWWivjwj`-j"m+-Iۜ`̟ e)jR"z!)~u.7kivKӃ/Q `(,&)$6\Ӯweyn;?}gevB Xi~8f]ffeH'I+˥ D3tyKӫ.g8.X8#l m)ZjꢵUvh+9ch%z'[kkTe%#.GT;vRUQB/2gz@È`g1/j7j~u vv6vv J5J֖lUء\ }Ocݤr!Z0DkP,X{C2v՜\( C?!GPaʒkjcFqY{Gj_WkAr1ȕ #P'X`s™LXלװ_Ӥ(L(Q%5jTKs{?Kl<;l';}T֪/,jUT-PS P226k}ך{+oz+].tw.*j?}ez u8Mh)d@H꣊od,Dj9dfα;󷷼Y]I>.?"HJZWyL[<_yz_.P|p." "IDR4鄀Rz6zMbdm_XLyl\?ilFM) Affwu=Woĕ$ߚ"'|K+k g |::;=")%%8tYy))8K`5uK+ \*IP % ]p}<IFRMMt=b{?f8mpBơR~*6 j3iGFb0س׍G0}ԮG GZo Zcj*++-*9dvάՁ Cm5X&YZ~{sogi^)uZÎ]Ŋ04ĽykRUO),ߐGL$J`wm۸z¦t |I$g!q@ 9YY᧬Q#2j,:z bJFK0>`|޾HLӼzԂdiݣw[X8 v8@H6(@T@0̓7F@jAb@p j *jZ6eg 01LrvۑxOOyO#U[-0T&L anTbaڠS !R4O@gӹ{~@&z{tn +~^'S$.c}~OW׉a%A#m0 db0㷅1zߴ4 n DGD00BB׽kqN#XDPDnG꿾^<}sU AG""Q74"n .7<=M*DԂ:*4tISMF玜M:PNq8j7;}4ݍ }.^OXý (RS]uыH /m>Lc潏;x8DF&IpZXj[Ŗx[&)|dHX]2>1XFBHMTTY i8fxoSKEG`,ҌQFl˙+\nlk@T8'P[Pq9E.EFdaocJZ#!,Ek"fQD e+_S|ga8MWWfAM RB#G2h(cd!BS,wZJYw?u"3M ZYy>k)21I 6,LT8!1aa`_=Q]]Zj VS`u ۭ-RS:G賮3몷L=}KI22+(a'T9SƳ*bPS$H @C$/MăËFDIS؆>PFV) rø%X"!< X>?a%&<0Mpw6DNwr+$*4 =HkdB=TG)'f//kmlmޛ}鷩}~]1NMh.l2B4Xrf&e fg$%eKne>nl ssFu_p0#l ]77۴x%rc3ל@Rnks)i{XLzi(#)ȩ!qe$ӈh IL0.@Kn3ya S<¬妋&UJ}*\R L!n5S%AA"D1N*mL {R1V^+Թm#|5@"s(5x;e ܉w&msx'8<^"ީ9+w OtN}YـMwtq@s!m~/ ȥ!GI^+Ι\ nxC+<58pMPd:ldFBF%kV*4,S:vԹWi* (`Br|O?"(#n&L\..Q%1DB!妋q(D6<Cv;ExYXmܗU[1b"&7ʑXu `;aO)5GP霱{"3^VYjϡTJQH|7eʒ>k[vsmgty{\Yr[3zBQ䗠C@z(:rQ"ӠWMQXly;o ;3͙=٫o a`Pu;n NtYp;"XWݥMِ_Q{?~tYc0UnsEpap)%rY{*L.ޱ vu = VjT,`\4/A8M)U!0 $O%ةF=GCQG]M_j*bËvi 4 bI$l¸MO!v]'SMO;C;N{&\t2 „NtIr?p]1++?OcRix9D(0D -:nB_a$@]*,Ʃ:+-J!_+.OC,GR¤A2c /Fe_G|^?WvvL3{5'5 L! )XcThu\ ۦH\0 0Qd/u'e=T% َ0N3n^>MFyzru,nI0BϞyEخ]+Ѐ|&u>v[s_>N,wQY<(([6LYh'ݒ211CگzLQp2H|o"DJs(nmC]~fbGￛ L ?Yqةa\NMTW=B̮j&~V{,Ŏo{o  & Qh66S ^&P?CWe7}sM?HOP+aTS/TR\jtXjq΋0@@L,6QyH9LQƌNNN˹ԢKL,X@CŽ/;\(\v#52Ju'ނ4%X _owCOP-~ק*]j$I= q<nx_fQ!j*Y:8I\۲|S^bocO}̇K%TQ飹|A^#Í)y(IA ε\:o 1ϞI!ak 'V?~/=z?,ӱ2ZR.^5j8[sE}\.eY iIS{5}: $ WgQi[ml^l-lʛ$, ?n@ lTCN56h`?WݿF:WUm04̈́~l J0bz%%|e"J [ius!]3]ˎJÉX23hd~Mt\]Fs!0iE&:칂ϛguqBQæMP9Tu:wϮӾjN[_w^sǯgcwAт d,uJG@Pr XdM森9 ĤX/1 59x#ȯQ~2ϴW]eXK[NQ(K"<5$쓴EΥ~+4@m\+msD[Lh*A)i\arzV\p45*E"8 jHiN{W.6Q)? +.7y%wDgN!y ,J鸽gY᳎b1 "#@ʪgSS\{ǛG[I9aMtQ,9Ƒu>rGW| ~[2L쳳.zw釡Hvs .3, O˿5$?Z>@⽧] C\( bB, !0 0޿ksvĺMF̥ݻ92`W}ˤ:C1 }WMT+n!C~ f8TH@X s*?;mw2l@ͤ.}2"ADH{ӘVmI7+:@ OpLi/KZM tf:~<3rU6. A"^Czu?u{Nc}?atqM)H$FyD\rukڵUU0aL/lK*_+˷u7{u r*^w&vY{ۯ+ kz7zLSAEUETO5^:Tc WSLb@`Tv<*x(9ow .j>LB[1i?aW/5)3"DfHРvxUަQ)|h6oKsANkNǤ|5ʼ hX ~RA+K3kay{^^ҫJP(oҳjsIw[hQa{ByCGO#{b7(FjI|rP'WW">dzl?XfL'@m7cGn懞wr@uVl$WES>_SGHfgVĜwNp XU>o~| m~`q`x2g N$ `$2|Fk\d9Eub0"=qlHYb&z TJm-ԚAc -U=F6ݤ˰ ~J4C 8DC "wK<;44#:NDbca"%2^j uZ7!t2K7@Ҋx?}]pҡE):MyGA3g\?MGxc`J'*n]M>d;ܙۅ 6q !%'Y^S>Gg?)>CCğ0r u %O ` ؆ L# V&ɬRA23٧zc &ST=eEMwXOk<=gh;GA$pZ[snܒ# ;TPM.xia {>G)I }C-&LQNN/6&E@ICEwjp[aSSr6qȦ<Cu(쨭EjEڎI搲0XW#ZY>z\P@o.v~5%AT] +QLiG (f$D)JE QHEy{a$Ć=y^۵@yIXV*^ai_j"Saa#i J0?kewHlu<4߃l'L ٤6;?51 D2=/_nz_~8rgtS~XS^G)W/&0?Cnľ|!(^!Z\F6ޣ&d߫[`R,`@9UI%Ogjs:Xf =--M=s"1!q m'QVN-%k7|φt]s7m܅,+03Ʋ=v~aj9L-{gݗ6x},ӣӮX\C<'GaW_ݲxQXtX*4K۞ cCpѫVB瘊!:U,DOfVivw"J8\;H|M WcTE04{k> 3ď]{Ċ_m οh:qPJ![n ]ʒ=V!ve_+azxYwDlڻE FɼZJP@J Aq"A%g/I6!@'uӒY^>s\y~SN 9ɳ{T[p~| 0:]D9bq ӏiѲda1\ ]y))JCW?O,.8T.~JξZD3~zOa$/gLlzC/)=&}t]V]]kSp`x׹%lQ#fpN q$E$|El3-*ٱQF## t DnRa~S=S'?+sr;mavyjYM]AB_$`ݎMdRQ`Wl0d$Uʐ*`Mn|ѳAv׹nMRt?ZN9C(~z0wT\<~C[9tY(SVTڵռ؜+W^`62 CPaJ7ӂ@;\-ZEdPgw;'<_.iTuqϓhoA.=dy=y_E ef^3e`&0؟=1G!PxsSg?o'@ϥ HpA9H,JpUh(>w뜍0,2p,$ :=k*gv Fu q s( A\p]BҺL ehSvN34-Gٛӂ4c;H~}@*8LYPзN(4Wi!#( HE H$ȔJlDacN%Woxi쳪]QBKbBi @ G,x@! UsvejL9LjnLN)cg``U䪤7I$^abK)1ߒ^Ҽaن)#쥂 WBN3wY{Ou(P*>8 @ArM̬Ϥ$`c626m}|Zt*=aS6`Qsa5%cU`]T7T4<@OOcP̺_p& <Gnȍ @ GɘS5(ߪ,ղLUǢS`)Tlz{M9<Vy:\{ˈHr]yБFS`Mv89] ˧|+WI,Dݢx#enܟ߭m$, Iᙈ-YsEْZp#{#H`ǻǾO1jfchcbm~o[r4-S-P! " A @ ;ݝoۣVw5kKz ʸ;lߗݡ[luVZ& XlF)w~,F Fc`JbT|;os9MvUs0#m:r9Zݵnapkg}W+cl ; UyUınv w}ig&gk745RYLAuO,ߙ #=WC/KE b4:J~Ɏ/U|HjL<% $1@qH.\\p#~\nQڲ 'wC+ ߅RPhbC)߹y{*\Ɗ cDp[~]a,?2A@ji,YPB@$sTH-G[[]fRw3fi|^ԥ#=ןj}F eCA օs:?K,{R7ԶvVtZ/jbm=!"١M-ƝTX+-!v3f#% qyqTX!\ϝYS=K~} x`_>i?!IL\"yx*VI(D&c%tK`(WS.u8z2 jsy]LE*f.߂g.!áz` ׻!>ު+_C)H{tPRP:>/rwۿr l%O=x1Гl'7+TBK.PR*)WII<`|^}Ya&VGDiЌaK1%>)[mo7'p>o$Swo'%mNjMjs/O͝7#!0RBu'o#CJ>Ἡ? nskZ}-~KE֣Q%cs!P'Cz@$@4g34G=qpM""ɫ ٺ $-(DwDiİ@hܛ:oI۱Fwg<m! czRa? I{LPۯ^r2K(dV*"ʇ= I0|޺aƥHAgxPWgHofXEhxwgσ1{2] 0Ɵ-29]\]N3e?utIV5l={gLŤuzГ>,(k!hR2ImτX5\~U Fݿ{Dŵk:\+vXG3a٫?|Lf#D7 _k.[ZZNaadٹY0as;Kü1cfswF`S<@Qe'V9T!/Q%'`:._RM8߻=q8o`yV`/=d7o[Za0;j{4P΢Y'LlݘA)/cY|"A 4B*Ab!o!bm;e N-[ТX:{hm|o~yh}=3",>-k}!qmt@(SW/U%7ؽϳg~#ｓBg7`혶^W~ˑDŽa;}6HYE2-k5AlG/C&!<}Hf<8gӮj>Sk=7OB` zL۝qACpq'"*$Wcfzݽ;d] <$8jp qOvX645$ Q/m,ǖMRԄCLzCIHvA]w{*l+y:5_LX/-sΜOoCJҊIZ]eS\* (۝ Q1z8Ht熘#S;HI6(wr(;ɑLOf$h$Zۈ1a~5&(ΥG[k14R~#/ǺW?QBv-d>%8D7MR4n'>o-fl[[[WMêvtjTT[5K;º1I+Ѧ \ʲ[Ep<&q&રm-i/Y[;f ǭY-4b˜KW,3+ l(<ռ[F&g5}fnx]?\CZi:3KW+ǕO' ̌Z2U$A$~FI_FlH, ~Ss2{ K,WԎ->ʌϘzad?!H9R yg4ahԻ^ž"eo/G!A8 X fqD jCa6i*)",Óߓp6ƌ]kڎ=C37'*dyGi-H)2]UH& '.tBWx،vD!p,+&ǃ֬?ᇢDiUos~y~wZ"Wbk!:E@*AtFK_!O LJLyR)>~Mu_v>Vޟ1,$ʳQ$ 7=^6;::pWzo9p>*rMw=1L8 zL@QH)yb+YR k,,X0lZ&E[7GnZZ UBzǁ^!T|_vYhdP/ivXϧʾت@^lR敀D/1[,\BpZ ݷKP@PbpQ]E/~Oӕ#^[?57cޏ֛e c[ftDTЈBU)@DR%+T|<7O]gHXk*voڐv49}ǭ iscK[~㥁%0R[ bQ$w5q:$X&xMC vuًaHN#?g ^ݞ΋^^<: s U"ĥ,FnH<w+O$;IMݰM/Im8-J+ʴN' .%1+;RFIpBJ>:PdH} $ |$A$Pe}JtQN-yVV*TJF MyUeYE!ov=kzg="σ肋TY ^K*rOS~.o_» MRB_|Un˿+(襨 heh2?'Ѯ ]g_:SAgcG1bŒ[ އn CxWg{eY Y(XwF_`77{_}ؑKoavjXƺ\TÈ5qH&]`%&@!*Ps% Af(2q.JX;'/;x4!čgI % 3i&0ivx(x-5}ӂխ גπ25HMM;dMM4#z jԧ$"AR`Ě-P| '$.y7V:#v,eD7XUvӗd+7yz U/J* sҌ3+}ab6#E'&N74e5tC !Aq|GfȨ. .ŊR-pYa^msg[l6W'B cO=m=urCk2/}b3W$"f@$dC0#>o4?CCC@ :."3+N ќ.YWiih&Py ܶo*oEUS)0BuԀOf4u1$I;*]%"33~6L%8h:MSxK$<6L'u`40搌SP(=KמN}m0/H`XUx#ü''{@^o_s79^DЄ TH.~V`9lH1D+\BJ"H:l%uc38ZNCq o$]^/c+½E(:4D$miІ{ !y⺼X[/sdZNefM"v;iMPӉDĥ86E/MJ߂̭XIT(l& Ȑ4.Ln3UbZR[[ns_]HνHϮ,]V=HdK*M6 ,d€`Q o]r)학+r{6zG ЏԱ8?u-i~`zM > _k(]ذPZ'{$ʈdd&7ٜ4Epm],~>\og;zґqh /T`a? Zu]@,ȡԴڎ|_{=Zh8jY3%kL:_mB@NDe [1ɘ={3yyIN'&?;'Aܙ?*G(>qt hf$U)+2k$C@ŸVH:L -yh9c>t*JB* G@x2? ҭzÄ7>}ǁɠ Dڣ}v#-lqCJ"W/vSL|vzGЄ :CTp)kjj"kjNğ1WHhV q>uO[G"&%VG˚wO[j 1O/S#_J~ (d' ) R5k)sZSDMQX]WfnQ$[FB< Jh`SxD/(Z2\?EFE튖gDW2=$,*]OU1"pu1sFcBS'Vm]ÁL \L I[WGDdHNѨng#㡡:Rڅ`Nh%J1wL̷X%Y;9)Gãf*fG-BM%`c\\0 K37Say܌`KA K+6j=9O@2OH:y#IDטg?~ yZ<01Z"G9uK-_eZB 9>yx#|2Y"O8_B,1S2"aP尐 PZVq׋eۡK !}3D~gyrCu@f?f\>dů&w 'E}?34q& b 1, 2p417f"UVTu565UA`eTqDѣF̜IC`j$דf} 'RV @8 Fe5Ҝɭu 1XZeArO3hv"ArЂ,PwhR2XOZ~wHƞƆCT^[=s#5ALaTch-*)d=2IhGTݾ..G|ң{9BMQ/A>D52* TtŒA]0Ts(m:7z7y CA{fwy+{};.$9[[N VK$pΖ~j e:GQ-D>T('LzbQ?FAn'P`'sA=$u#  0yQ_c]aerf@ [ڸ|`haC8@+ 1$0GO`tspW!0f:xEL_$I+9bii6X 2Yr $у& 4 6y!)dj"rG y z)Fg'vdiSSppqPzq40wa{Q? x3n!4::hYE_3d";O|?v$I$ʂIc{~ K(nflXk;d^ec!g$ɵeV07Vϳ,Xy9CYΧ3G_|G8d@QGnuk g:@̛8^Q9`dA_qJcz"wR9$LvkNw#y/@Id{M} '**s[s{E^V f́*Tsrռ <_CC;aKGyۧ~k%,?:BSP92> *J ٱj_*VWr+MŲmt)ëORhuw79Ɋ'3;-)۽%ߣ j1K0DāucdW}o713t4;`q֣M`CʧI3c` e&PNZ_(F[|fq9Cp?duiZeLe oJϲ@:c$Ca\sifdd()fשeTu4ty*jj`.U5j*`|ɗ#o][ɿ `^HI]ZXa)#v^I|#*5p9 -FmQ(AICGP4x6u[]OPhJ  Iy y'9L R0]0x%Li@&@ݐ im<{IeWk]xx'ߏo%"QFXk2aJ q{dXpS f97C1P-P) iʍH]L˒><}[$.e9$?|N20RۻD˕' :Q5R {`˚Wmҹ]㬦(@PuYf# Œ V=   ڱcj"@u=0wkg,

Rp}0lowy-gTȤ;/F5-wbv M^{3'K[ֺNZTW7fa tp fgGZMik]I7N 3'~D~[=t/OgBk玊Iى"ݫ'rlSiF%jh7"RÑmqHb)CgHU: 11E48\B_ w s+"Ysr{qڻzٵ2/Ryhb7-,=ԞgU ;­c:v %O_ˬpwݭU߭V*_#U&pw ,:| ;c0bR%aŲYFؤ޻c&]\ 󴑧Lv'um"EgtJJf }W^[=hKdu~jD\AĜ0ry=3vlnA[A<TNdE\.۱Vv5Ee4ۑlSCBYǹo"Xdsm"r+\5IS%sPM.5-!,B6kU#vfvb;ץ_S.+g|!f'Nj!#"[:YJf>ͭK}ɤuPΧrplWrK \6nJh<< ^H3q1ѓkӊ,RjR0֝Kz-@>RϯcvE7$"5Fk2q]K-)-sUو;mb7\YJiN"LP$c0 |83r2mP$$naHN'3oˇ4u磱U CWO͑co!Ic\:/k.u XQ5bgPҩfa *\ԕgw?rY00DuLA]v=Sv'q}X{~:ˏ!D{ 6q/,윚_l/SaIZTA\XVJUc]`Z2r=K&_92 rK_wraC(ckOk:u~QޮgCg I[>!@@PP 8iY0iFVl/]` B˘UB|(E %4R`\%3~˷@KT+ՙdq74 v~/gS{`喁HN(("F4aK: Ǟ.vsknv:ZM;=YwOƯC5H68zhv?L{Bt$Csw˿}!=| p{s0B2͵Os$Q8C>_>%Ѳxx{pv3V[pHMB!w ZpএǏ!5c}$Ŗ J4TYmP3 kFM_ip_v65{?Jpd'ۊ-jpSM!LΧ#VdwnI@ 556n>%O]Sx{Exə_,i&Q)#W9ULfa߾,i 17'9[Қ 1<;|Fٜi*K> Y~LZTZm0X-8o,4=Yڿ:$w.Xp8'?"{ @NNf6!(?Ó*(f莱nl`γv&yѶy6vIhl2}1;64ڟH*H%uM_%he UEᗬ0m[4b;(~yl]RGogv1xB+gY%\fLՊ ї)ʻl.Wb,wM |a$C`afC85˙!v/L ':r:vV**B]%ʎ,d@g|Pz ӗg`Fe0Ƥ,B4lf.!fn\w,pI\!Re8\,9b AoŠo bv($CעV@/m} (i>A=Gfu❌V!\ބ~XZ63kBdmL#54fs%lCWKur!5'I\:L[{gӆ$҇a]}H`r4:ϑYO쇋PZ"ʮ!_[I| nvb[ M 6= [:<6(ZZJCmz+]x~> t%fҐn~ò]n}9Os! y Du>Ep}['Ci"<) q%TrˊķԆk) \omAMD  jkn{P+0&foPM~DZ C[~ SYǪD-"=]U[&C%Lg b¥= +0i$H\ٝ1qwO.KW}l٪d9a,-D0 ޖJU鈸 LylFK&6Zڊݒ;IY+6A 4#vF@$mR(Fylvwj#B@/1kx^؝F[)׿Hs"Dpԧn9UgA3C+kTD;D/6u:8KՊ\&㐌.C**x-y } o92pNtZ=g*˜*TE%^Ծ9aј `ZIw-[O۬ޟ wwZ迩M1'eҦ QˉjX`oK00Π 9Ҋ pu]G{gLm"óg$R#|ҵNB$Dш⏻v<~?|XrY}MFȁZji+ R~G&FQrY2+g.(!,%ڠ/ݸ]x-,zyCLԄ4 _>#?̾ۄ^rj3e̝j@L@fzڃS )IIOJ]fzbn8S  "V)D[w=yE>q%,l6%z-I GtruW} ӆ7)Z}=A(z^ke-Q>`$G\U=mw`{oM+Iij  y 4E-mkDuk jVOU$Uޣ?Q^\뱓ƒ`@kрX/T/ څ=;]&03ڰK3Hw If@ʲPow*,6uI7uGo5}}Ƅ230CzOts,;<޵:,܎T~t}ڙL'|?Vq٪26l TP$p%\@(8Ņ7nZOu6000J5e֍cJA J׏D S( 'A)>R:&?b(4p_ yB uSzx9Tw2},v2eep:(3dGD4I#$ Z h[3W+^lA$A$l)Ƣ`-h9 I4ykc/~Hfs Ew22pz#|3xJUt-euoIˤpAR8iGՑؗbpQ.f vDUzݘ J@ cM%em]%Jl2O>Vhd(L2p-mlVRm,!L \LN^]yuWzt9E|~Jj .rPn0CM6 L!46[:$Rl^^0YQ3<ΆIL{QCfhbDQOӜ(x5 o[0ɐ\WTeStU禣a.08M 4q@$)?y•h)۝\^/hcې:X;ǻ |B6D TL frJnvZXܴ(>is/MC?( ٯ0$HT:1Vs:r[jsNDy|(?P)緸YAaHB34S\O߅xp{gmOPly꺳u%1l&MVYhR`J&BK`$k 0cCw7T}?Mk@2$'RJuTdJWv4V6FS66{6//g}b]୓Y.,:/ #HyҦQx${$4S<$" VB>-lV #l1D,Zd!T wǹqeY{vK PI'd;JC,iE 6Jpϯvጜ5]QϨz6#!2A "*!JHڃ:0H6Q93tԔT44lTUgKm.*lSU (1YyZZ._Nڌ2ձ2u)ttEqMuzWta?>Q>t@"@*E=7E|rJ7 7=-uW5BE&LI@t KGdnPj\`cC[_u{>\QZsI_RkZ|ޔew2;/"T)PSUQUQj8\PD5 DH@?`/i8(J'd?}!B` :K rXa- cqoqÑ&邖< Vlh|ea9i|`CYfXn|NC ]ƞ,;~CLlPQ= f$DbID p "($=+wZ[V /K#3dC ݓ?` vcFi~ ˽{zǿm,&aN(gB(-)t9=-|r$"I˙01!;յs|_jH62Pm8f=/Oop7W"c]平c $6ZM 13%h}y~7d}/-|b'ܐֱ6^QDFl7D\ߖ"7tR!Lq=~Ѝ_uW]!%|+ JRZMѠ:vD$ixI^ ⮿&~HMa8L"}〟TN"o_+^&3R[\ļ:hy'4uVxUK հT sY>VZ0R$$"bJZvM dߓmPp$)9,<00I ;~9tmηvN m]}0vݥmboqGI] yu+cN .iE 2 Q#k.AeLòZ) "b1@qcSϙn7?>Jxa{VI5/hb3z䣄ĈOU(c3ѦFeoӉhtGd$ &@ngkx~w>&jφ=YU|UlkAYocf D-nmŎgB& {>p2|`|{ir28G_L&fANѮ_"D.Yx;te~*#Hc>gUb#,nDz ⚶yZPE 猢ts'PnEw1: O6̆ tٗ:q1{VcwӝLvrNsG*K. 9t()iSiꪪj )*i )J?q י^KkP+#ғ4Q瓹4.f?/B({Xީ g,{R_! dz7vs4qO#3}](9_ $G`AaqDD}ܰ#< ;LaAY xe y'vgO-*%N߁9FL.{$JJm]^_g? gA5Gݺ-eT^7(ۇ3)QqM@+3yA3L H P,U ک !B: ʺ :zKU@M-)Gќ=T*.',~FL?BgK,1DPH 1yN{f{zX۳7-gd^_yͽݫX.kL L>O1L&B%UJ,|˾_y.ӢԮw]g9.82yQ0Nm7M45ٹm& z>Zh9S'3RS5545ܘTҏ !/ 4V^ǢևsogVw2hjJj ֓hmvGvMQICIICMQCHPn#W~/=2zq&<-+3Oy9]MtoYMSvkw\N ZQ. ul~vyi)/ҭFa0ܚw {+ۡ" SAߴ`-wrD%)=C}}S]խ5udhšnӎs?QEw-ɪճ>HO$( CWW,uv6VՍUIw3@M=)ӱHI4iiQX@qT+5 B2*(I#$2 ALB$}jz^e)) B1]%!JHN q GSq%{[lyxƪ۫Hmn*<0TM˯,c6ˬ^ia^6\⎰D~ScȊKB?A.ņT fPvyv~O⻞qhyO&f#}=="#LJ<~WyYŠp̩]4G ?(`z޾hqQO+y3(sYO4XƁZ4*ӿ;^}ǽ{k^Oea`No]A{MDj5]Φpgk]ܾuL;} Fɼ r{޼֋ tvtwKWuݩoB 1r!"P?75)w'u]Q_R6 B WE@`2T`hPWp fiޔn3bhT4*h'wŮO卌4E_>Ckʿ#/aCtu[$ 67߅lYQ5S,%I/d/ؒI D,_(|Ho5Lk]*t34\'O҇S6eJ /綏}h W _g:ѧaLz͵emu=>?a`^V8PtkDK$"-[ߧń5"cTaY D<LXÎ?55qrqe G3^X}2mVs#=a[̳:c8dNR >ΈJANCf[QNK6|~4F%$AZho}x |$}͇'˜9\e#?ZN[7e2* Bū_ η-Y ~ TDj "v-k"S;*};IfM}&J%;'pb jnxێ>J|ܳϣw 7zLzE=@$kU1.^4l_ETP3Pky䒙ݳ$e"K30v3ȱK'F(1G[T`mޫOĨw^\4}<]}x&7 iDp&<&[*J%zG˾cW[G.|B.=$ AXUsC!Ov "j({ нc,.?u2yG~A=+YO@A vvOKg_>T$soD[Nn/gw_[Š{WcoӰ kʧJRD޴VezP<>Q8aMsu&AV:+ Тi!~'ey&DoSRTĪ2Q JxPRXKxr#ѝ? ΂D^ 2[Ӑǿn(=|z: >"F 3#b+Xo6.PLF_5!oGUtKbuM oBʿxZCx-1աĈ lGcH߉/cݔk1/9>95G8f-9)L(UB&i7K8 +l6+|z>*Kxa=^ya^[vzPrͱ+TXavWa,IJcŰTHE32|Jj(/%|oq)!!L8|-CϼA("J@>1vE * џ/}Ѧrg.-r>cNGl37=8rܵSo3:4/ _ ,/Ƿ~ I\zo|2T:۾c- % w^6<48e^"0H6M;ÔOct۪j<&Lndp-Q&qԇ<~7@/S+gtǥiދRQLA=<:@3}g! vx̊]V%cFै/tZV Fe4ڄ 39 5g 23l7ylg[j?ɣ/*zta>ey عN[ .Hf8m*Z8zd 0"k~ +}W߄J ~+- L@=ι,ĂxD>ԿGGc$n<ف.U^?QMDtj}ԤX,UzpRt14' @ *PzGŻa1lJq[ 14}ҟ7y '4pYnԼOxlKNrh._`0>ߚy;۵]t5W8Ii~6?e i J@zRFP )MaV V:޽PHjn"/"MyU:.Y/vLH ]D, 0)SJYJ3$gk7Fc;oXgPrGlo.UJ@ΟXV]g~/6OGPh'Il~BZ4F=ۚGgsNJa4UQk`q5S<%%pܮ/7^񟷻cFoHBMD-O˜,: 1d#;zM콧[蒴<:tъgMBtb I W^ZZY؇,%VV ؇q qN^yt,k/ɩ#w}M-'#^Xw|vZwGEUJHRIL|C>g]q/}~U[w7SXcJ3!PQFSRuWzꯞWwgWEx `_w h0Oky&7[mg"}~)bdt?ԒI$A;*<ƴ|qWᶿH'y﯊۬xd6 cXӋӗ9atgPzI9 ݤK!AL%"_oKBҾGls8}L1y.]|']'E^:։Gˑ+mbb,a0 aw`Z3*i~.J_+ސ-& Vd;]ߏ%;u<z>_"" % 呀4'cb-t8 JaN\wY4zm_wwi&F$. 0JO@(R!揘2 Q'7g .!ZfrI7贐O)n.Arh4 Ip^%v~ckKSwv^ݭ:6fnc'qC!FGW 0Z_G(T@T#A{|@rd ½!!>]'R-5$)Y%ѡQ&],]OMTz10iV%VUWVu:tBBU.P5:=Bחa`LdM9^Ly9N P+2FjЪ_鳛n/i\]rn@eaaPgV%&%$FȐ:gY:W':,6A '`6ƚgXUTuNyUAy" S>ܳ|̀5gGF~k[pF\j UGڂx]ҨTgp\mO!I߼z65bFDUO#[Ry-6`&y :%iyK/xƎP˓`S0氱\qcyyyyyyyyyypYnvypu1ppo9mllKmmL n񮮟Q ">mE L=FxK I'Btse"ح"7r KNUJcE˰Qi3 KGއZs>{P(T wեԭ.#=^MW?֮E0w ܓĘ*-6ӳg΀U3[ΖIfO]߼s17憷RD^QF +ZŚ.a3!~rpo[<t]5 ;[{kכ5Һ* @ `s a"eB'B \ HT ރwjZ+]U 8 00]2TQii)JIH @+ѯj!fEb_V@ B/c$8=~˓Ij{yRON! &WZJbpK>o3dz*0 CD@#Tr naw†E}+ 0uه~ց̞J\xҿ2?}W+kh/ll_*r/|JI8abumki>dj=d7n%6k$A̠*+jۥO#@D@D5ȒE_)e !C휽rt(SRQN\ٙyhN+8Q};ƋS AxIJŵr.Yɬ2:ԡLOfb9?8n" Bjs75L2֙Z[ BC`t򿒋B $^v*$d,0A@>.$_abݔ -I,lrd*t1,tA8Y$>Q,O_?7au ;[zҊ 䆯ӍtrQ~ˉ}#..=OR@ Lnߧr%ds )pBp(#US x|E<@ψy)sYõ080Rg E)R':7z F@L5%9?d-~7I*.L Uib܈ "ǁqp.bԜ2zIJq}B_4wgybh)V@/#B,Zi W ؛J( n]|%H˱2_J߱ˑs|e>U}ii>/_ 2h0HM)҄ &8RY3:\o_s΀_|Ehl7/&lXMa\~J TE]CZyEop픚P&>=}G&`isộ=<roRn屭 Ehs=AFyj~^ɷqGu4- /隄w" Q@st]Mh,yF %FV5|FZMYQh 쐢~jCDZKt RWL,. TkaPi/TKO }o:-*PII7duo lfmKX6^@\@D+`֛dϓPOݑ!݉I ,յ kˏ!%ҎzM y|To/UKx8/yVYYjC#NV3 ,k?Rirb:%p_v-\Tr3@Ș#?|ܹ! tR c:åg7D20=;x4}3SS]A*~0%d= ʏ nRsjծrb<(~uʴ]G>sAuG F9:iQ^Ouew4x_Uq W"uza;Oɴe{3E6_ 7@b >л(>7Dgg6ȢzO=e!L5?Jm++OӸlKR>Tg]1N'Plq8&fS8[ M瑵473QY*ι>eZή!RXĚAR09F9)MrT\>`O /[I6nZDvHO UjGM4&Nc)|õ[*oZ|k:*кx.T("v+"+G릒v,Nasl r[4?oga͌Փ49P* eY[J8sϋ2irZO𭀑Κۉ4pR5g55PPw.]MBcwvg0‘"wJk=4m/leJ IU n<[GltxYv)z}Y7k2.wQ$6}=j*xv8B &uPXkzQ4C;*aKAP[;rꡄ $ZzS9fbM kU2bB-g͙ikYMZXkLϋ pQp@mP{W_:b.#j*WV=~ntN f)*-絢 o]e~|u~k5 9AjdorDB|ԎUqg>RhSWIT^{~PbWU炲= 7v'$զ+SXOxo#Ϝvq@L%Wo.2LQQݿ\ L%&\q;U'2Eݹ-c-P4mVcR_UXŞ>2uEW3|?I: eKѯ-J(?_oEJ'UI(xѪ4565L: :z~zfW}ѩUuCP{'ٟW]ffiEfm#'0) ڬܸK5m#86*-g;tQ`W_Wo%q-9O\lr6#Br#JsJL K5@YuoaR.ǨVËϳnbZu0u&}5 t{q!C4brL7QnXU&sqWc"8un?>N {/ SfNi̍1loѾuK%|U.!w̍5X'b$ WMaghc&46n-u󣖊/\0 i]_T A`(}O hPNaG^|؂dFE6蛍"ÁžoUcf+זgKrNmZ pHa/KE*t3Nr2H 0zLoː$6{a$\#PI鹊1{b3cƛnHK 3,uf"kٓOIž4!iW WR|G(,76Tt}h%P"]6@md&S]ozՆ| ,amm.U*ա |lv ϜR$Vތk3$74' 5|1&F٠H@ ei+>;\H̜Q`fñ\-:lK\i T4Η<ؓ kcyrIK N4"~AI @$']CL5jxLHȰ3=ﺭD_͊Uk88L4+!'^#YX&+C DC3MbRbOx|ɵ2nI䶚螒K\E!ذ'0I U@{gu*z`ng,?_1Q7<- 4<\>]OO楎تP4%&2i+-5|oQwQr@X6L :ӭdO$xxԾ~*[(aB&84Jyr՚PnX:Eİi"{Η zf0-FIMZ_{ Xdw=y)aGs?zň9hqTF;iag˗)Bͤ2kWLawN;MCT4ss8sї5sғ{"ʲ" lCET(XZBVZ-RCcATߟ2d 7>6c5?RHEݚإĶ7E8)BoZ|@(`~'̸ԧD\r$qR~5KN}{ʃ;}ϕҺ~!Y}ժ54 f]}23yAGMNlYxJ#-_ΙL|RegO,ܥO'^/A  LTCTjJɇSjG}qiYum^_k@cOK+颡_RƠ3} Exq$s}TbV`QtڥC$DD,sfdB sQEJ}R,-+0Lu}du?{9_u0⠻\AE&qo%KWb` [ [eiv⣖hP.&imخC8G:@G@H 5YH ԚՒP?ּVַVֹVּ)r{uxf 6x@$3!*2WةyWZ/kH|tz|߸7= 9;`kN/<ׇ;̶Z됦㘄{*x=kʛF33] yP  6{8y=\LȩS?Wʝ͚S332ÞZo3]}Y5 Gv$%I-H=o RGvCYjVhwBB;Q ?[;*xw!̟rѿ~7ص156RF+y${ wgV]}Jg)YƧsoa8NOG-z-\% 8YԎ灁぀[+!vƸξdq ?A#RIKvΞ}oq5Hm 9l,s$xhRR5$cS'D5^ σ'g>λCS_~"NxzdkT)W*kF|ޚvQd9;ZCMk,S>Yfݶzkge9ZE0<!rb_#$$ ;nl)hИ`>|m-3ڵMˊ>1&B ٣LeO7CMPK?=3}zh, ىNբ՚bZ<3herM<6H 0a&COG^_׳4tu1%|zE1`2" zxʈIъ% LY@ty'Mz$T |! zߋ,b֒ÉT8uR*;hLK6vǓ~lVZA0/ TVbE (+N۩7-xwB0rm#uGutuuuttuutuuuuuuuuuuuuu!+uuuYXh^[3O93v֥"EIh/!XrHw_zi4pJ5 ^ `@c8l@p`l#aƸ`+qe .ۻ١#/f5fUdYRXkԿc@210j2& c\;Ck f$`n耳Bi$|ˁ7QxGwzĹ p`E_qZ*1/Su]]j"e"@8B OKSk66lt r,;dswoP.y992-99999999990Y9490Ň&P畞HYP[2UT͚S%B3=_{cD(oyAqu7TTF(MHVOo1Ɠ q'Z(`=i}u?F?lk=bu1{< ^íl?%Ъl;>{} ̱Y_Twv7=@o7j EDjD٥;6g_྽ҫI֐$$}|;%~g󪁏}B֟J F ę182'!Dc&k3~oʀ"?" ր9TF5~/aIޖk^hRB(D!B7LViJαL^Oopmbmmmmm\mmj_-mmmmmmmne̵{ƻ3 A^?F:oA(ܬNvUP D!L:8j8 bvRFGFY*f|Ȅ|![g{9C/31^_|AU1#dzZ ͌XgKHKAКM jo,Ҿi.hEͭr)jmgDD<"ァ% Df^* 9 6)W3y۽qNԙ05 j{2{X#FoI߼CֻhHЇG!-T?_f[.BWK PƧ~.ì!8CVp" }}}}}}}}}}}{]|}}}}}}}}{=}{{UWmXX׷mg 0D af\^)!Š{G`W{H}Ixs^:u.=>^BL Dz#Q$t^?~\훭w5U":DL,O)qټ&D ~C䮚 'jᇼLYw7[ƀS0OaCBSa &42I F}]y/ 3B`Z2A(m $(ȱ|ft^=\*pQ{#j,wV.zSTx/DDi0eS< b݊iKϤ\/Gܪ]gy{=g{=g0.M?V.?dcagr-~vW2 g6hmpX9ۙ Q]I NXGGbS3*U͇&Ĝ/+W*EêH/sB-:7<yU8oh sP-hC #wFM^o=`͂t3 W7}`Xmcw7󜦏- ,T\طuK4:hy}깅3A0㙋i0ަA#  BՎ"%2LVds!iŸ\n#no@7L@06G8!R^Ya;Y>2Y,";=Sd=W}}w: \/2y7d@(6@"Ñ$߫%l|XzjK<.-`ۦ4(;i}$( ;S[\4WwjBU& 8lj8a 3WĎ`E0׷W궜+ {]`vv8\l^ds`8- 8%aA { JodͻxE_۳=^?UvV1R밓s{T iU!L*BQzUR 9dh@ ==0"K aDc۠{d} ,t*qia^612ыT3L䛇?I+?!_e؇K<i A޴pRҟ3O菉G{9bT$# 8 @j L_з 'vxֹM? \&~]Eg#ֹSM8 lr <ᄓ3`ϥeGN,v ()(Dv]?[eF֏ Yu,,m  )*2*`{>x:{cv7;b+^_K]ůddc׾7Kx_>m!2mq7UJ`,URYF"+wD9Ns7V[W κ]ڋ;/;tS6)O/׼NjƢJbL0fjG8NI$D.cT\u)VkԚ4Isמdz㴬 a3̥>s-?oQJ|!V4|V6BL#u"C0gTÿQ6_ M4ܠAQ3tkC#k}#GLB }3${{s'm =8{os{НCP(f)1@ۈykx/`I֝O.B ma4q*TǰG\UGު Fѻj`4Guޖ (CĎ(8&aH(Bż+/:݂.IC!}y'erݷ>LAYۥU7Ss[ęT]`R#1*aÊ:Ac3Q Zp(s-=ejν)p׫5wc)D.OAuЀlEH.ZDZ(ۧbo%e&'`mjOY5& z5jdɾo5&\~[ icL vsX*!ʲ ԑ,> ӗhOO%Nf6tU42uX~^X^]VWx*"9jVo5 =<ۏ(Z'3gPo^+Lړ:Ś S8gԄwgh_AՎEvhֺssk=l-nࢱ2_-Ԙ5kfxpG\bU0 C\#v:4c Zkѕ/|.6t'2LKxٔKI|nijf pn$kB$\[\WbZEe.{&f`~ YVxa LF[C i~NɨuSaHт:XȾ&`i5V8Y|4g#ѢUam4σanޝl4M>FhP,H$$ l+KK\ 9;[kkKIY,L ħ&Tߗ /}2}>lV|B9e̵͂Ɇ81'3+ *,bJÔ=ԭ퍍{඘6%7ExRfo:dŎ$o0.#bV('^)^o &A_w:Ћ$BԔ-6V6& |q"jPc(\hD^b_7t!3I%ݛt6 h<3oNO; 2`*ؐ7vś]ɶ81;Jӌi2f)7ۖ٤ qkuލVή>"N|"cOE97czBZ_yN 򽞴57B7w{{ˊB];lYgHI6rVբݳ~@DD$bzZ_J|W(2}oFVө l0 ^5Xтtuڵ:OQRpxn=E4m-QeC-;E5f^<2N$ŧ ӦIFԦsy^39hFeMvV#Ċ!t7˴USݺ5ΝCjĹqHwR5_'j(:nάՀ־6XRea $Ռ) 혢(F*0݄qQ޾IE`XhA&}Zr7Pb}02XgJRRwS:}#S[@V(mqܓeʢ{ngND:sO}L"[n*ZM$ccy/T` yv`(q5 rph@|TYE)$`jSk-P}7%*zY!As̟?!o? AiO]eFK?qeUjyjnL>QVzNS_ .:IE%QS2-?I&ϫw@扮A_v5P? <{oLPRi˼>ˮ*i`P;ucr|`Gq15ޘ^V2SZŚú~҃QCtR^Qn;PIٳ>y}_"2||f_B=θw|ү~zV*W+^{ q\n;yݷpc?$Mܨ<;~Y/ةfZULZBDC+Ng@ނ Kq )6ͽA;〻3iֵnu:`%j-ӢxhN/*PD_Ɵ`5A e )wb`[n2ϾcXV+jN鷚9,|2d6['ŏ~ϻ3;T Rkc_y>򹟾 EgYRy5#OcHebrk-Ӕ1˴No7 {F~cKbB2>ovYM,ӖycԬ+wОotLRBve \Ö9Vnk4xXVFm/.7Tr^S,NiZl3TjDWKd@CLQaC]yiK4L9REi-5O O.}jpQ;]{IhxykPti<7qk\=$_'Ćŵi&樧n;b79.sfOps"O΍)TK Iw2D*fP !,@+@Tɠ.`B8a--țmUQX(6cÈ7KyjiHC !FXF}|@ۢDq 2kߓquqqf4@d~F\`zX(#Д V&L+2-oP[ Hǎ;i1RI$pdk ftŠJc}*x5 ʅ2pn=V||ՖRE͍R8Á!.ʷRI-e&bK`ȁosFpGDH-nlL}{}ri8F w/S_o8KЗ-ܷe찆COlC D_|^rوSVQf'0!Jgi/GˋC&ڤٓhJ>P1}Wwx$5SҶ}ggIh v@ FozEbvVIi?m]PC.g }ӱL3Y% ^}G{{ٶ~~Ʈu;:ޑߨH >qd},ESQ-k}\/b*e.]8!SOaQ7.vhs3[ФJUL pLV?Kq\,z:D?N[B0G3. ŒO ɐpc|S,ƨ; )M tRҩ3|"fm?xmw;]ʮݲtC7[.p;U~tX9 vZM!iPlPeȴNDDDDDmeP` }{>Gҏda%! ?"?::Ҥ:ݡiH;8j@vjDDA/2{HP6wۖ0}wA)xQ%,;{0'=&svD[]K@GgeeXMgOe_OQfa]c_^iieghB4N 0uր,cd`7_i{\4z\ۚBl$H*VfƆ鳦RܣIEul]8d\zZ@yْd# $N-:; tuߟ4s^:i! ua@#M~#=1?\xL}VWC_S`8;{(h UI)NC6A @. K"!tFF0@K|&,Qɚi:JTZ Zg7myOxo]4QڐW|!+˱ Ja6l!߉ݖY/PVER<^SOKgp}-#f(T =$Z9%N"5WZPȂ6H!Q50G˥XއћDžDwt;w-SM}qI:CNa@8DZ9ZxS2SzzZ;@hCcpA&7GFH⟝#7ĒNU9,JEP.J֠obūe䆚'l+i*Ug!i*+lk:JJ- vb A]vaolA&K2HJb0p*ҥ$_Hp'AT $Y n-CLhvq .T "ue}zE%z1,0 a! @sh__:lէ8+ ~uz\:nox˃_ywGmݫi瑕uO,D l,k(()Tik+k몬 .v3U,I?Mқ9b!Fuǡ UZ(r)s(Ϊ8Q/Ou:;%Iϧs!ƃ9c[[\^1`bp:]LcLc=' 1+!W3@ q͗5yn|קZ" FAt)_'/waC_ {7b8z؛o4#'7(uixZ?;7Ϥaa5,w|]ݮI5,gڅ!r١] ∊IMP;%IN@;VJcOq&yo HB@0,J<~5QLہx!4" L! -d؆ #qpfKP1QCDnUD]REM[[mRRZg#>D (ՃrnvyrYo'M@{N2yovz/i#69#9!UHf8!th)ZRnI5cMS?SKG:h)A2K8Q)GXׯ=Q cɖn:rA`fynPh^"weBVvLJr~?ggv۾𺨏a[8EEUaRGL$ HvDH D>nAT+$&g8]aXȒ&JHDHݦ-e|\{O}.y_:\%|#\P9Ay6쉦ϢWfztt4v5VEM:^~ƺ t S}}e Ȏ6qI7l7(p%(SxgǢu1Gؓ8OSAJLL:ENX*ߓ!"] " w[ZAHĜUgyFϻKw). (r1i}HG܏$>KP$ܣ aĠ4a0Qz_}C9o󟕾:ԇB<@_N!l(Iꐝ3$ $N?7 ~qA^MNcG9[>(\@XqSd$̵|甆ov*>8x!+.5 <†esJ:PGo0H8~j7~_\]M6Vm$i8=iLOþS7۱ř'qtS^E}@lzae^<sB} 9x 2{S@jPKdZZH-8X,oRf<565 {#HL++ f%yRpYjx=׵Y}c AEESQ͢I!x嬙Y٘f9"@!D@ImrȌWD`IQr%"fUG`:[Jc#wKsuAĸ{͚ L`qޕ8PY$@P+d}v`4N%rF'2P2%daF)!`\Y\#RnbP%D:fb BRƄ1+-Qrv ׈G-uYSP wE:MlAB-$=ʵ~k Ϸf5rк/xX$QUn#rJ nk\:> "R<Pݲ.)%U>%زI)V" UW֊I=&H}V(O;>;?|khg9/inA֣C$~oS UZUK%4 Wƅ%ۋ/TJpזڼuh/jwWV_{۸˸/#q0,!udaU}vw>.oϗo>]v, );K/0bjki) @8r@`(p{44} 0#L;މ,4 ZpvsWZB(EWqTfkAVTLKCl#~`y$y0 ۰`2|ΉIu? a2M@@8C0Or wcdOUNlm"[5 B({(r⨱'6}Ҟ͐u+m1?z= Ʋ>}Z(poѢuP~ׂu~s몌(fc3D{œ]3sWk}[׷IdH 2}ݽYIgMK[xVwcEL@ (8^ )sp%8@C`Ia-h#4sWۤūaVjaX5Qg+:ukzۜGgV =`*(t?׌SFXcóEnz{ip$w(S8M8uδ'AԂ D #QHH4 =r/i-5^fWP&)e:NۡI߃rwm@]wR?.mtٛ)?DϘbHH$%8}M6BOklGnDb0FV\6@n.zL<8ϠZ9y_{*SRxS#si!$WN4!sa)ߐ|T ނ_.aΓ)uOF !Ґg_!V%GAx{X Bb s#{iHgQ=,5gUUt/@$bw ɒ} ?Y9LJuw벋={Z@ӟ^Y,blfwAT𬿃  ߫*. $Gg`<}E蜦~ow:d xff:\ܹt#wژpbQdEo8mql0B Q,gYL] %&pjZINݻ| ceB$hg=O&+wNfU+W8~Eg -k U PQI7 =5v\U`Y*AN'=i`e2~۸.&M4^>V;kF=hkbLeWw_'{Q)\BZӊNVmgf4rlq)w.Sw!j^nEO|7pH@%!?$\ӇD@H H0C6YF :s,BBXFs] `.fF@p` 6m@V<-ؕi~1:H_ /? k, )p \A'w4Q8Jl#$ml#4S?6}OsKb8y_F.jh.l,!GPCi'AI eilh)zdq0U֎MK8!ͤИ5j5Z=liTmP|A|E{Z|?TN8ױ&O(`4Z Ā!B3û(hSd?OkԀa'0|[ 6f#cYYs❇HoF]+U֦И{*|d׹i-TۆBEYp 2xɡΩͦA%:_O5Z-20H/aͥ/z4m,zI;nh_7>` ,[EU}S& *ԽGN?]'!@D2Ī}J5$2SpCe7tcczEZZBu2Q g,=?Ι7;i̻˪]kA3:BI5![Gů_k`,XDmjy:Kzn7dR0HW $b wۼ-͉={`6J5 US>%(,VرW77uw'$ ,MQDqHF[: եκɮq&D RYWdٞ2(uxӪeJ Pۍ A۞✌nK6DAq㶶4kH^J11@_²3%N)^M_֖6n|=Ei /mR?﷛uv o6* ybolgHO5ݛAO,8x!9p;qr6vkvSlۆ&{׺ .t!+r̓喥n\^'6^yi.O}u$0s$I7hbkKcGqv+uF#"cn[y=S@ۤ?ۋ9.HN68/\KpiSctp{ xL [_b0xR\dL04L|R^ēnn-s\X[k زua`$ k-^jX+V0 z-n ڳxZ)p\`C@{km ǔUA)fnjJEV[YW״y=cTݚ/sh_2l98-UbqHcg4`~kYj Ik>z=-*&`aߋ׷VLɴ&JAiMl[n3{_b,06p-8K+PegQsъ[t/Q' ~Nx:YB)omˮqol&|ոN8+l;O99̮-l\xm[ۚlpbb~ 9C6wleL &ͱmmomod; [T-Rafu-9fi§{޴W]`Z՚[ۍ|kV@{yeN-dyY!\(pLcr{KYul3ظʀ\,w]ӑ4RbVZ7@Űu74%f~ND^v [\.|< Cϋ}{ 3{=3贯ndgAP"+Jܯ+ʼ+t>3P3NgH!.|_4sˣ`9{ɼVlNmjBi Ymi >7NS:otw ضu|!aL@❾+`ζո4yqᭂ-Y|4oz-T+fpK:}no}W>*3bX[q>A\ۅJiC{ȍPlF$:8w4mLm)4p6Mũ6N0ܧoqm4+) ks&W7dz{ Ft}b9UW^En@UsKL56mwcNΦ)yu1 6&Ae˷h =Q{؛?Zw9$ P 1գjZZZI3(S6G߅E=otD lpe-3q\G(alꓺ&:{Q8/,arTek|zo^v?zպ@*ϗONi v(WO9]32x!hY-طp6Z =x9R7Xd lwֲ}+AgR;{m(]++W[u+W^v:[ >-'@g|0[)# z:@aM Vgn76DzQMҰʟ 4 ܒDhx6x4wWoD sN! +Fe==0cϷ^** 0Ifڍ̪S-$AJl7/<P2d)L؍ Xŀ+R-R-m$bf q0#Y q<Z0U)"(1kJk3YMI",>K੢]x=x# S-d]'LM9 ٳjզ4H*=- 9[n8]grkVŚ$ʚSoH\lYyWVgszuV,IiF ΧtfȧY- vTg*^EtJ9\Sœ^?38^%Bm3LiҎ' xf0(o=4w&eax7S7p'?ʒ>N{5LLya'L$:*/DW'65R$}k4TϿ29iW? V~Wqh,µuOsr{{xaʚՁ1 /\*…E('(FE8D:ST2RLHտyI. +mK" [[b?O sS󖣪(dp(»@&pk)8٧cO*;$ +Iְz<?0;JsyϤɞgիZVl-QK ˨d*G[A3 2G =H=esTp'dRTo[\p!=ɮR[S} T d:&7 7cbJG5Q̲N4Mdch,,T}}HlTͼ.= =>jPBYqjk+M}sw/b[r脥|9{ʾ+ecM}=l;P@Ѳ!G8)=g01Ĥ$cT^'lK;Y zY2Ko4ǩ?cc5Zfӫ7έPIڂ YuaXrx6TC2*l&W16>VL~<9xS:y=j yBev/x N#}mὛޱ{NZ|okjīpSpnalfa'Wy‹ufػi6ɗ'ɽ`6Z@h|%! J +״Œфg6nIXȸFfh!aM+ |8 @FojX/C-`aW-ڝؠ"ǹ7: PLSH4%TV9?Mҳf-dyPnN͍jƕ]WcXۣwuRrkSk} 3{W EyHNj h1Df{aiC7| EtcF\FD: XuLQRt7ЯL$3}/^ c8M$LiYc:a7ܐ{|n{WlU#ʳ>~61*vO통]cis݋!J?/b=.P)/b -r0'ob!Vףh-w73mQ̩ob`>7e$@@7σ=@\Λ4t嶼U۱B dg͕&dJKZˏp #9a|c|d"5@l XF0l"bRMb6d4D\ɖ 6@dJX8_skTj 0u?F9@ 51K%/]&"?홓'ޚ?}1ڬ}kxn ˌPAQHHx!'>dPbL`+na pY% bQbJhyKfGQ}ߞa!:_fܑXfgrT$'ǑջQ{SٮKF/fLeb߃(ʫ&gwU!5<*ZS(9FG:_ɤ? J\]p[fXIGbx]^j0Z4 Y+(2UXC*huwiIʓ2c]z0f ɯP7~%o/0 r$p8!&|_/P> ;׋$ۭmZr?zStDQz*WX6^pdF/gvP@N/Τ$I~>0i|&dd!Ȍ2@rG$s.Gei4&Gњ@npq×&O6&{ 0]]UF s ?P7hS2~'H~.HlR"Cd0 e v>{=)+"Ŋ0DK DҎ2|K g᧥^ckZ:g贀$7BH{4Hf06[]]e'[ԻK[g}Bk ߄HX(P^oOD;)# ~D4SG, [.>==J-+S!˟ޘ Vkm>96S 94QSBáH>2y4q]bMpž!-!pȣ>|VӜp}T a2n9trǍF(y\b ^-ˀ<|]Y}2tH(8pC(`(ʚ:t dBm>g}xpȍi$d$:y5LotuCsB z jl &͛I]mc#8YÏ~h wgQ }8Po=VZǏmZSNU o#6SZ@ծ#X @jիVZuue6lfg#6lZ\VŽ'8BF{8iwWABjVI$JdI4I$_$],$ߗ!Ut;?;{ONԷмӼ'ힰcW>ʼpéȪzhiev7߁ʺx}w2}7K|mErMMeXq˼, 7YbÐ#7,(JOQtP?>!Q3:Sņh0BRe&\'^" ""=_po'0X#Se.B͡ڴr"X UcPK~٤);scg_}Jڒj@ "ǐ`6Tj6Hw%H qog>IC,iY|C BqCs08^b^Y˹y|kNK彦r9OK5գ}~tbHf' J7aӦ_ZȎ_Kn+#rm$7isjhd •Mb„YKU3[2#u-TJ]u>yo}~GWF QJWIe;@Y---76: T9) /xEOą X-݉hpcҚ ,/ 4YˊRMzN0⦟CŚ yӂx.jtn'Λ*Khri 4lP9;m(mvsfq}b[ eƍ_Joa4mViVf޵]T䨌D}]v?ޟ;;:lsɵ"gUB)-DrP/s2}w [wLY}X}-F[C^g.6'_lɎIntE|5omO]QIK^~ GsRaXo ~3%7\˯[Y[2ˏ˟gRmaimoDD ۷{:aIBB%^x[r\'vRRPȑBȭBȴJIqo2bR]T⣦7&ʹZ"Q711)-H&.:2%z*+@mƩL}n nl6B]gg>H Q ,ݥVºB+۵. uY`L-8PX#,I*|`|||f1We=ЗzeezTzҴjշ,kq0O! FsonJ,U^ﶯj z7Ɍ>U{mHKo {-TSB=$2;7xBA=AI' $&yjQVAhN+-ɣ衡*>0!P˙Lݭ6D0b~\:Ed<9XhhhlhxyHhxvw?&""sgQs8ܴոWHָ(Ȧȍ4D=DB֮"Ќav9/p1V$:'\N5Wb yq*@ q#s<2${ .T8ZF#nSCU{}/i1IԤ0aO$%$TTv : $]8mUoG$(NϠ^gy?o3O:yt)L>!YlKbKKKP,vCҙXxeS+d6Xu2LĐf'GM 3;iqGEn2 rGS|CH̛;fezqwƫ=V>{ץ+Ԍu9K-LUp5Č^5ղҵ.LZͶmX賑.]KyU5Dij#XmB?3b#%ܙ.޹zdG4n#8.CXhr|n?{XԂ-b_2`K[po{?dhѣOS\N k1ܯZC2E'bbbQ[NqcFƅZQ84p'5llxl- Bl 1 C ~v7{|ɶ0 {r |g"1豉$MsgAZ+g]iSeٴ:m{GʐO#KH,i$Sw)ii;53f Dq?Ӷˋ ,Ns\g:|^oi9`m^uH߸Zݚ615j:fIX>IqTr$!{^_jkAHfsIIe^z @J$%dzA峼<>N}=5rZ_3Vzl@%Z戥u)Jvh>:i2L.GqC+PzNX[3"iLx`Nr;ciHM~ELQ6h¾p$Qu8c?S>+?58 sR]홽F-`kNR\8N@NO\l/rW0,Ca9(R`ˢ? Cg1֗zq'sAQuI,HPiOxklRgUmh껝npQj*TSڴ׎iWX'lsK=vƉ/>3^4ޒOhD?) ^<=ƤĚ,[sڪ8r="cL[%(כ&w`xZ]gv\31fFM^e;"RroL|TLM(>ލ hfvyۀ- yO/Hn?鉢,@@ q 8z&^=/ٳ2jx. 32!7-fY]-9Gr}ãǭDoc^LWɗyrʵOkf΀@|]@" S 948 ?u'0Rq$c|z9'kNT2lCq'e={fI wߕXTbJ Baȁ#$,a?`;<}PLO?%1Zd&F?7KBp@1) JN^^k!Ko|}KR&WxL=Ǝa/SIh0˒#s~('g>iMsq9ru9Rռj%bF'V=-$?:Jo-㟜߼9?D/Q3V}--˯% (V~qRI]'VHmcJ:wFd b W{uFy߿0X@%! 3/ɗGi\%~zL p\Cq1KNg?TxW_csVQf~EFAA5;~X~0;kۦ.rm72Rgpp):xGVE^aeLƍY> ?+gϟ:2Y-L q@ZBY D鄹9(/Xa0 !Hq 9#q Zxo KզDi𱆛}~;>k%pJD81 ;[,1n^Ylnfhl{gl h;FR 1Gs:ڧfx8do'.rD>yh[co"!,LrG{O1$zLV=ER!| bǓuw,5~W~M^%Q eMzS&?**Ⰹ%*wn4\K|/p=7< P qRJ?ӏ, ]E$Z.Jh_DߘUR-R䪩4HE%!}ES׆\OY}^Ϝ1oAJ,33't4)ȑMLMPSTSSTSTntv=-]vgI@Ԫ$ Ek]7oaٴuE@q}WYQ(F/=?}|߭t)je!t坦H"#iQMR.X}zq R|J5I$BݙU>}5W2~T0iS5%/vWޛSg.*^•{ yKⷠ:&B)oG)-G(}tdRGzϚAtH_ss FG,_,!3 p@ir7--1XN6Nͻ(t!Ȳd2cd·S#_[CGfW^~U;}qTgS^m^+_=N^3i*rx|DI+vОwݜ@C8S81K] 9?BfxDS+9'?L XA0X@|2аP!L9\^4/A5ҷ=eeh4P1Pd]#QTَraɗ\2|UOUٲ8}A]0!h.bzJ 2;7ҤfZK7Lf*ڤ[- 1 <ᓌц^'u$N\":(7;o9R:pc2e0J_9[a6ϵ{֥*-Lp9*d?ZgS6N-*uޙ_y+/MiO?=*. H95=k _aY nʷߤ_vU;6\ a]k*BoE^&G&%RzވO=l*qA:?q'9<ň~wES 43K6zʣ@ \b$rXĴ:JؔR 'r w"C^[]Lv>WU\1Vs'\U%{i5>{n,XsileyW{6Iq8ݙ%Eylřju ] f/hhYMohv|WOT7 %NGŠ?4h3=Js%77~^^o9no.!$MnS5{ yYk.$CQHAʠ$f\bu6Jڊ˨C.pOmf==nI{u{,)mNewq~+֠oa*!/vwY#fu)g'Y^Y{ GҮy8j8!&|j=E3{TH>a%M6(g<lxԀ` :z2tHrV?؆5!\A\LԀ]-/H|/aN!ň+'9a8AHV󴛈Xk5<&c2hFQKołWÇ~%9%+Òۯ?tHJCY ʢp )dYx !V*ò?~]!6_)n?SB-`4}U{ Mˊܔ%MWZ=iF #hn'ߐ #'B>+´ ph#7i(y`+s2e}=;2%UgK0皴e8DMC H-P>=_;Yo"-9n #9wO<>dW) ͫgG9!U}@[:)G+Vդ6+$/)۹&?n&U9Oa Zk{^&Όl7 0 ( )9յ/7ҙ1,S jgNMǔN8!'C%/vd~Q螦^}"ZT D9 Mo1lo9DL A.'Lt\lFq O~1?"n&{a_C0NgI~><$!?EIC_4';Hh2rJƒSy{t%w(LRɊQ((''OJP`JPPOŗ&4e\[ /ѣHdcZӉ{Ӑ@r) mktS[E;)ϝO:v!!5?xQ^g\J(K+Y=:w=,iOٰoO6o)67=ӱπ0Qoׯfe| )^g^.Կs7 ))PK=HNSG>z` @@PS6Z܇!j[-Raϻan/|[2NsBr6i!%Kyu{M/z[kLR|{ Vw ÚKuTvu(1ےy e-oҸj[$U*mQƟ>FiZ T_ѮhQ pQ,E%(7u2|7K6jglUUoٖFz:f`e3hdAs%N9\I]a{|)b%-(*HӡAҧo'pm8u*j4TJm/~9;﹜FNs 5 g<%Osט 7o=1w8B bb H_(ITĝZ!6|V"Tr9J/>ek&3M{ɓGk!BtRio ^&O;._AU%=Ni E"0afHR_hU Щs֘Mɖ0`F= ăC$'Y M-s:oOLOgg?&my?gF m%ЍvV>cH! ];^*ѹAŤYa 6EcF6G ƣ xy]?#aj{j]#!ᩡ ĩ@Zy1tsu"[4_DڀL_P̤/7Niv]Smԧ(+XLzJy.]2)+|w88K#tSKtTOjdEg7[^\U\ɧy͗mR Zѫu4MYYWjRrQO#jlOmxZ1@뽃rBE9$ʂz6Ho#Z/w}u"/)ޗWTa[aOzps]DupKtttrۺ5G^ݠHqF[јi!5p&pؤ]dddXXXX|n8yžXCr7";^dzU. J%2^^L{g]#^]֜ؿy*}9<7?[yVGEGk}~醾{0a>?OWt~uMBsi y8!k1E^쁹o9FS Z} L(Ioy%Hj~Ѫs{ƓR joF{gzyFX~S 'Lڎ 2L^g/, /a?tƋzXWw|ep4.@cqV3RFbspm\֯a], c꣉pp#=/7F?D\Hc-d |pj\cYv.saPsgK^{4PAL HtE]:iQRdZUo]2C4=jȥ0[ LN6TKh4hU){>;fU7[8zԱH0Kz;L#%iک,1'. 8[v3}?n-6qlz˥2+DNf_yR{hl+f][XL%f{oG?sED  tZQ<  'yϴcd*V~`}|5lkNge]g-xИ>^fs%JzW:\)ݥx/kiu5_;v$'[ރUJxbe4MhN85JGad}֋1od?%b%kQ8^ƶN 2Ev)gIi둤'8l$),+-*o:Yv4lGDd {3i >G{y|p^~D?R-Ljr<9&`X'}.~SgB0+_w7WʫqI6dÕOf%hK -肹yql\E4[=~2'HN8v旣1.\Su\CJS:A~9 Bd,%Desfn)aBv%\D>9~ ?"3ץw7SHr!0 m(M)ME _p: zrʓl Uh"`rRGM]p7; :{q}ÐӋC2iV:C7x[>\MK}duN;o7R9Pg$.h (fo{Q98 2hDx4A_ 9Co#pи)~`DU\)J|}1we:=G5PWH@hmSQ& {ZյxhȕV:O0j%#2#PC,#td$RI>ڣ 5>/CeSt=^31M'2g&HYg[Ň x~'y6la*=&~0w϶?\"sHNh4:}UL4^U ^S/Wa#XlвWwv -YGG CϏMqu~Yr~<{4(Ai1u˚0>ih,M霼 )! tNJ:  ? i1ioC?}'(kgBtSrES|G wA c`hmQ0W*-+euYBMqHʚ7R1&9tnMK2?jg嬵+f.mؒEKw՗(T8@(1$p'p⽃`BQq! " n,xGҴ}-GEU5 DoE;*kjᮢYZ~LAzK($Pc)^A4s_Pjs5[λX BB᫸IDAC$"LDXH]v='8z5jݻw-XdKW<܂AU ~aju# }ykT:푣[#GfvI;RJ̮:eE7&\e\͒I&{K ,&׻?΅'~>L9IE{6Mѭ`m|SWW3\ p0.8F+DX'[ăq!/OOѾ#1#%FԘ% kX4q͸j!ĩz_7d`QP1g}yJg)8}88o d(}l*c6GڝjY>!aQ~!T 5#׾(t`ɹM hׄ]8띿.:\jI`G|G* [o=>|K?ooNu?JKcq'xzOoM\XĮ** =332Ap!!BH~zXUg=[_f} xL6's^#=UP8Hh@ɱ⊸@dCĈ1s]-d)aiX6;9H fp6a :ha~:0?KF|vU 'q&&( ctFvaa|߽Jo43ݒE&ex |2#/qmB"#?s"+uϟÏyHqiBtA<)ܕ*e<>>CQhϻ,Ge}/17KslL!fk@jo|B!$7_y gUl9NӼwa$2}~)'Ш7d)p/0Bclaalf={MJG"+ -e~Aa6oȆMP@:  FK\+vK[Nj ;/q.u1ϧ|u{0ŗ'g Vf=NM3't'`Y p2]Cjb,ų(D@q u} Mo "cwWьag_a>ގwPRUACl@olP|Oy=^#zWш~[>]@djHNTn1sbuUSw<}z9O`|}罕cˑ9M_.kLtC5_#Hl܍| Hx[-,_AG}T76䇕Q8f<K&jHzzѽ+󒄨{ŜCȤV 9 mlQ<>g֏Qjfm3l/x??9%PuNi:H*'-N\ٰU7Be3Tq(Iɥ_?Y<#x#|}޳a_=ưdCRtR2O zUVvIz ' -yG#g==jQ@n}Wb/~$$C( mCc(K lh sdsf_ |uZWke i Sjx67P XQ?\[ēt@}QT,e/n6agLS?.GfW2ȱ!}i֧l\!%鵗Yث=9]|C t* dB_ 磀k ŴެtFߑi PԪBok[{3*V`f_)E#o[*{K'3tL[Pi.B&3_z֌oM\[(`k E;pgWf ;9x'bԞo_20g@!!B\qg^Gj-[$ $^vM-+}7Íg1F@CL\\D%n2!qߢMﱴh)p ~F}2s%6!+{'Z*ӄ&مqu},Oe4-_u𽯨?;O1QPq;zM9OYo%q BmP >JDBI)) rr;.ySh'wNwP o~>gQU)M< ,`32`bh8 ? $` {w;L&s?>m]3OwtohIi6y{jw3[[jfѿn &൸=i}J(]C/=48J8{v}I]}Gǰ@&cPe[*~Miga̒tRϸY<*\Mv[o d5jO`H~TK&[>Xy?C翟iOb'%0)DBI&T6j Gas!s$-.kZzy 1 S3!>/>( W Lq`jC1spG@ ]s\|?}@?r$O\ }RC}vfW"CGz;D?RB RVr,߰We>6OƯ=~<' ~K98 %\p$H F"PR:#( `T!2.":*QI J'8 p`6:(p4Ȳ&XŠ %}ez$s NEe_\nɵE=;Y(0㬶D-^}n~1Gdl 1% w_x6[~]K9/}o}ODTW[TRUIbrQ,?HE!aZ(xFaw& f)o1#uR!iHIcJMkbcG+X`HeC'kI)9+I4XxVt,&8`dd#soٍ)@锒GFQ&c[L,E+W?+FEŌi}r>k/N&]syss*e r0v6WQ8s}UT;L.adOOVoѤp=y2d>Qԣ3gV)_ ˎk ElvR]lo{e;bQo6e+:j]m7Mk#~mqvu]'u<:r $q@p7[i7;/tb}wluqYƉPdݲȱ>vԻO]VgԈ3>=3f=OMzbD!8?Cv5Oəoѱmûvv!!LA.(V+D"LRdQrOx` xHΖ*b d9B*}h*MIHƁsj+Rb \ 7R|;My6W{[Pre|Þ)l2F}s(14`KhFMPB\=R~fCrD)05r*fǯoVA?׈"vSv:1\d Իw X TDFAW4 I oe. t),lrS7M%N-OB q$o/!ɏ[8nC!G(ڗ裝}qHr5"m}Jw: , cK'g`4p6׳Z1R?)|ϗAei'Ham z9:S#E1rl85>i2B5xKg0` _f?QY\' `[cR:ZZTEPfɵ~+lH4?8+Hkvuk=q `11݈Eߧi1쓔t IAep xf*{>~^tʪi2׊ϽhI^N<&6&;JYP4gu,+7-  S/^i؇=)ܲ0ܮ`IH[Ep XcH2RcjYD(O tU|//d.6Р &:>SaT FPC@n1UIHV?-QfbvM!4*nr\\NuLRR%PH)Æ,Q5+b>:kW'M.7@)Ѱmy;k4.eF'{ۨɞJ8ʰ무#cmlH!je;v7AMT8VAȤUU+HzG]M0q͠|B蹩WRTb-"Wϱyl#cŔ{?qnseN'!70,yi= tؚ.p΄rvS&7$%0&lI#khTn,tK=tsFU{ Jbq9%qգ[WE= A^^v?﷩z5-񙞒hz')εbm~dƃ@hߓr]ۦوonpm`InJ Д ȉxr @@s9R^;6C̹muy9f=5+W6V[E~VL݋{t:@];`%!s* 1D%@A瀩hxخ>1?i%`N&H==#t##*UM~GO 1 g|SOsd𖢟.S5ku>. QZC t`[ IGS ;ַ&'7eqו;2ZCΚm7?e6;MGl8fKt9diD g"M¥4(GopQEI3 (@rjEW[-`zqmj~{ n]'J@%B!B{u)/Pbdv G87[n,0x;N/A'm^TgOwJm<-__C[7zvGq.ޮ Gfyͽ3>KѠg3tI}\Q5$ $AGd[ k9Ib \j6-[wh0Y䄯Y<}O̓)6 k.Wb8ق\ȕ \0* մL%Nɡ1M-aE oRԏG \tcߘ:8 هf=oPX8&~ȴDžJ#\4^=!XtQAӤ\[zo 5$\sfاDWמ}g 63?Bv̠  *m'ǒy{_6vSQ_WӠPnv%hUƍ+t(3?#Km+x嶉ٱ f͜j*P^2A )RĩT#$ -&J b~y^N"}4ޣETK_3?#- !*ӷ-JԣTdÕӧ6Jl՝ثO" FrP8( eX[>I^etLRZ8&n3i}x^D!'s f･MXU` H;kho1h9l:^fz;5♁JJr7 J:п`Yt[{$gSmoI'd5/ EFb wg?ĈKYYFɏ7(ǭt"b"!Dȹ;otCn.qμH2+ 緉$WOɗKQNeyW4 Cwo2H;{-իG}<>CIiw']/?,L21|VЊzAt7'ߥg 0{WOƮJв[$j-d \G5n`Z t H1=ᯎ٧dl꓿n;\5CIޘ)4V\lY ONL|,+}|']s́@gpIC Q6igns>֖eC_*E֦J+Y  %RN3[݂ Am*mmP>3.q!~bC1~|_!xNq`? 1>y-7)1-brRrzg ȷUm80fR qCDj|*$0`R#Kd[V`\S"s)>CN6,:$J5X|+T)9@0~|Fk47f:iq쳨W}hQ7 f6mu13ZkHVNeo 5pE8ÈGHM@YG(PO5w<̿wa68ŷJ|9UlQfDny6߬9om|lԝS@,xg4n2UًGXs<lښwUzes#vK]oط Ȩ8?8jU"dz.0#mg{.f=Q7;6:ڹ^LK)'[[wUYwܐ}ϲ*%Ѹe!mT0Xr` H-^ H6&868vlukws=eFn7;tG7n5-)k#1b?# \̴ΦW>lb?o8/yp^!c&[ rER|v̷֢ϔ7rSt}I<ix/TUR#L"<d<':$_DUO^eN&H3MW}tPO}éj *yNWNJQ mIbO" P wI c>OXѳIElc<NGG*amTTYu߇9^;b\sika(MgTG~ ]^ :/sdey{μ^7Qz͆)% ! 0 :roS^EtP!ƣy0g)PwN܂.>gtZ}7 QԿ-g&-V}o:Z˘&wSx`M:tΞfr(!\@sd"ru=#nh}ߋV] 9Eo׸n&e=|_o%MeY5 ; QYSh)&W O@=Ny%zDoem(vYjAmR6uXk{nYz>ZXStG0oHg]RYsV)ڋ(8@ A LcPu %sGOǍGU`[:~g/+T#ɗQ륔Ye>p^(w"hWlD3亜pӆ~}F$ EI?p_+tu圜Dw_#¼+i.H`9!Ba}7гs8| k(S9;L^O:Icsy\-/LÝ˱Yf2]Uy Q'ksW^ՁLeל[%-cuS*FntEKٛC_f4_Mo|V[C޾'{*gx=ʞD$=މ\i0!;t+$7jrE1/_ [,08N~_k;1W[X~qUV=؂l'rI{4A%:Ultm *d˥9z큄!+$x 3z&R,^ @[0Ha?$ "6B|K#:K>fons~RI:8[*7x/@Ԓ,ׂ^*]>˜/5 ;)j@!UƃS_*'635\\gMcSWQaujާ=[G{pZ5 'yWuM+y uǝb,߻>_6%g`a=/wϬ>PWry0# ,"JV k1 13au2.Jmn/6ddKJ8ZMƔJ&Nӗy~uNq|m$-;EQku'cLDN^ςG!Gw)Au*+;?#ˣo +Lr ~dbs(5vQ=O8<UnMa6<)Tu7yp4D>lH>Z_e-HMZd(Uoie8^W鹲4:gPs.'' 3icX^}?.p D$*O}&>*EKN6=wz|̏_ *hv|ο+iCwAn~Dh+ #]ci6֍5M3O3ɥp%k 51ߑ9g]~:qԡi2hZ2~-U?No_||{_q}bg9OvM*^-i~ *_|)ɚן.]/67ϟ.=K&6E@ "ނIdA@@Z0D1!\sޜ}?gm9Ym}u3s'=*(KlP#a$dtS3kgmcqy]#B a+>I4L@81`nYs ~J-M~gc|eR;o_-3c(FZiSWtC{ot{7_ ` L)x QVvq#w~R95bD aӪh;,#w 搞vJM$)~Kwǽ^[7<m͉=n%}8xr{/ECo3Ūm,WX_M 2 ҳCy=;ڇU(C MҒD| ?+Vdԑ1xI qDGJ5ΙZ z^%Ks{ih$̥"2 4?X*@[v2dGe`:s >voK"'8$I@ >#P:FZvbO5`Yi2*Zwܢ7}תz5<>OMgqfx3ny{3N]Y[R?}w.\R1*LL2dɌL?%5»VZjԮQ >[ jq4Eq~w+.Y)O΂q_ơH-ps[@9\@TED8sX^)O!<$۫ г9y{:=>ſGnpcհ.pYުhmoΧ&&&%(IT{6ZZSIU}Fyb:ABpHCpwT`>ՠ{/?an=BN4\bO=PࠠSY?STCRq 6rudӕf>|/ Cأji~l`4(89"#,(@Lf Ork[7.+ùT)Rr XkqM e&͚Fw!q{W!C&AAcShd7Hk|Iqu6v_;GT|FOGU|FNJָ~ i2fl* ȫ;B?pE/iN?9Q'ߊx^p$H!XS x56}I܆)Tco6ߞ3g^ bop8N > -"Bz{var4iѤ̯Xj_k.?VKNA;0;$7<#G?<-?_b5&iO|Ss[}P@&x|5}l$ 46a۔a^3mƙ U4!pk@.ʍJ> 'Mmk&pm,Ƙ[* xՏp_Kpgwj^2-X&:zn;Gѵ!fצ#˒S AR(7UBfDs긆~ЕΟJhRbPp@nI^Jwo#e |>ĆPצ:ޔ}E9NT+sak?VŒa9a.Zv] q6ż4: ^|4B~ȫ7:= Ɨ0SuOfOaYqj~짷ҡz7uEGU]q(|j{](ƕj]CK=w A`ZH82;}aqRW+]As7/At9ܞt{f;N=VUYpE`^ Xa~OV6QTԤ I*'_ A!N\uKkƥ*U P/Ъj-`pB@| ?-սzpN ͏89vmyf/wIn^?(.*}tݽrD? FAo$KLLL@ Mp/)ffke_J$ž OPGzD$Y٠/T*@JaÄF?}g'6Dh">rh'Ȩ)/Q&iGg&]|;e| @Eb<}q6@PʆRTĨ|PUUUUU|V5j&;aRJJ$T}]߻ʕ[zu*)) 'g`vvro!vwC<ϟnnnͭKf)zyYȔ{paomlm\+<*(PB%-aW}=:J0GT$?0u_zO3MM:>:=*?vvgg;:ljثS P@$.5[[\oj3w=>=zD[8GOc]uӹ# 0ǹ.:s6VX(jPCRs(5bň"mj(m:IHrvo?/ܖSN+u>ZsDu~M\B߼<<4---: 1m55565g+XuY|-?m?w|ޒgΰ}U<7c箵ujR?Ox.<1%@?Pr+mZI=Ӛ6#Wa fßޑ*gXdky3 Tsi%)I,"C\#솽塇϶OüKXv]~} gb&+oqԦG'q]l3Qf⟱9-+[69sHH*%ur,O }K Na,BiBsU}Pbwf\tl3. H% d20#uD`~686zE ,r?lw NW﬽8?T5T,ƨ,r̔2 he:.Gxz׫'ԩ#STw^}?ͻevՃYB a|Vi@rc5˂Y$b "ݶG^]絅R{?uNz0)kPn2`%e aq Ba%-4h0ڠ\nLwE"{b_I0"`G>T^C%u'5>|_o;o:~WmҪ(z28UTF;v[@!tp(b gw8P5P:nۥDsy(8d1(\G/lI}v2 5wr&լ"'ja?wxv ;JvM([hcٖ}yxW -s.Cv~۸= jZ{-j%x|Ge8ty:@smUZ(6-ϟfv*E`kOR1??PyfPZRc^ۼ )e`D $Z/ZN\K\$!A#&d%&D&j)ai A]Z J佺ޚ\"S[$"A&$"\(6?4-b|0`0X ">.1T_cgV\[Y>GF;-lpmJv\-;&F@sD2e V1v1q:;n..)ݩ(b.C"HIt?l@u43ؐPM0;glp|wolJuhig(PB/s54HW1uv)ew_32nY)IF\]cfɴzN]e\sS#W]SZ-sM \ 62Z&&& AܬoV.)pDqcbAb #XcT-?+CcTa48ec~o| b@3&?`; :YIA>qyGo -h0c9MABBA~.9,._ \\SL c#0eem5ƙ(,q`d22Mn }3x>{JT6i1:Nj͝]q{$/T)YAӷPEķ]4x`-;DҮCY/)l^\c c+LtU^+Vue^Grflu[p/8; Ưte `p¨ŋl)3?2?? Y9zC{sޜ=ڽ!zNM<-#4/s?q @k~M73@????oZZ+7-_^g9gj"Qigxyb]ZZ-+*,, aIIfibecR-,״m?+ ȭ4=ͳ}>/9Oq܂ֵTeIޯ~m ́  aqjoGڱίD R hy?zhΡRΥyfɦ{dwuhwe1\N6%C@>t=w0eE@HN!+"D DFq=T nP9$l0 4͒ӫ32/mRC*btS6qە/њkOu(QM6{-Ӱ>`{maڡڷ1c<زV/> VطգeT|5u'"]U@ԡ]RRRRRtiQ\Rf@Fƾ Zg[b>+7{߷ӟ%ɶsjjS62,p:gp ˾ty޺9;uU*ܻ,9MܻQo/oqV2f[DA v);vMJ:n1#"I6R8W [_݄00] CRB#O$88;stlTTTTY/-%%%Ku$B+tBR޵555=;GeK9rpaPOW%]Þ?K;KIU7ՏVi((`hhZ͙ 4tmm-0 7mA=b LKSS4KLaq3? F3$$m%=uY 7 vrn PN2Vnvus\υRQ***Mk+k>Ej%mkMml˻i＼̬+MwVP f&fqg"^%b " Cl+;{~v egvnzy{%o Bu+]GG2.52)%"&- F%FTwsxDMeĠ裣\S"UW(((h^yvhhfҙtƶB[I٦ }~}Ӯ®/̧f M%aBҊ\HInMq8I_@QP_PQB(Q4^\(0\(\[U!! TϷMRJw%(IfJ7WRh<4N4.; 4;:2IJqʷh( 9 h(!phi2A窰Rgn@5M+vU01'lPH( Jbol!;wz_>V_~.~l`c &lSIM0/-usKhlW4vk%%nb-vkNuq O*w"YO5[tŏٚǙNO 0_›E3ap3;:S`1W =H $x/7ëx-uZHXw;m6TJ=a -aLrfɗ6Kpli-K5 ѕ>W}-^f7ָs_=Z_zSO2Ęy+ ]ԤDvQ+Ku |̼jbkj`lv5ˍFJ.&nU,OleBŽtٳ:-푸nWNfvYo[RDDW I( FLLjqYwMWJ.n!Ői/Q80Hfcy^F'h o63?"HBf'89@@ Y2oP(-Z ~|ǻ.i,C$$X (rF}޹ecoS0u5A>]S,ΞDl^SWMB Z `zj cV.DFl?O/մ|]k4<ʸQ(ѹ.їwf&2bd ﲹ;ω'M NI ??ygy*̜ )k~08 33T~7.]JOɄdĶ'<];:q`S fRaBux z)Пo M.CO&Y%^eºo$9m%HNnD +@"+;#9G3ʵ8nѿdq|eᗃB1l"}&tkmnhx~h )햛jfKy34@B f<,'~C)L>fH[rOnƄXa:bAvB辺_pz cv=% {%܀H vI #G2ci9 dHn/y%7HH|rzkiFG28<HI!  w2L$~=-}uWfD"f|0w/_ " @}lr`n~ A?/ԌɏG}On?O;ГȚoYUV}8'}kl[;Y{?/ρFTg3'|@ U ŔD@/z浨$w>֧)Kt>?^h_ctJpl"q^?;m4O `t@8 K$ʅgi|wƽ0?a@?2JTd"0,lN_* +S +d!HzֻqzMf>&'[ r[R9l՘@经ѵcSǺ? G3{* )νL!>5;Y| mϩ~[O^iޡg?2Gar+.8P @8ORDR74}9vOPOX (P&ݧp9G=Uvm4x6uZP5x˘H3 C @0x鉸~K_t|ht>3wzq4^ذ1 gȮ -?o1c:VQ\ITA$\[%zʩX yP+qtᕵJC VVVӦq"C/ \TN]E ﯱm0mg9Rp򪂉kr* E``\"(z.` H3=n21ϒ%S(9A!ˤ#4~m?bT:f}/{ yG,j.?)*D~eQ dQ̥ /[jMmL.nfFM''Y`. ;O]~N6ʏyx? 3`6'B7n8|_9^.;C;^q[Qk|㟞ndN0$jji2H*^B1Qx1huu0`322:>.bhɷ'Æow|1}d^Cf,h+RtQ°&0?ۓ ~DѓA4[:#AsR'{[.-W|*\dAz \$h׋Ai3SKx7Xd PC C]ޔqƟ=_gPbňU ~xg C3q/Lmxxf~]opΛ}CUPII U$ о,eQ2 $"ì. (8:-]gqTt\qAYՕ]Tuw@L{_glY_} ^ߏ:[A*$}dk[w6d  s`q?N~K+E;ۋ, ny2q# pvN?(Ҝ[~GWFBh9N0Ku?=lǻ?t=q[ɢn!hH//H黃}_e|omQ䕿pGԁb-2b񼗹rJW5 %QK;^u wѤ%̧(|4Uus qheiTjt2{)}p?9Iچ"H.1 9-]5DgA}|}P`v5glY^I֟|`%_pGS%xr.,FLK#}޻U7fM~P!觰z[t2=/Oz8`'"o.s@3?>(^c{W۰2'o>ϼ̭O1@ng79߶>A?Z?覩GokA#~/Gӄxʙ?] Hw?w`1?;so]M$H$~# k@0wڝ|*.glt`.v}X4Z0Xŀ:|4M.ݣðk2mihu]ѓRIc0C !U]UXfjX;7m/"޻mf.\ CcϨsg\jr^'Li.tKm\^"<-VE95.(WavR\Rv|m+NK(,hABTpbނ$%Y)ȩؙ%YHF]Mu*F'<}@$( RLCs_g~?aơ?dx'>D9\rE4H''D('lSTTTsS^i-(mCB F}`vӒYx[~\ O@BS>WY&wn+IN駷VG6꼘q7U˓=.JkC@D aq!}c+;ʄc,1q >`K?u{L wGrbNC68IHx-L RS)Gt]et]T\Rt}3޷ڨ3*:ibYmݝUە{ی;p8ۮicT_V?1qPgaQԽl~x߾{fIg6v2<;>^\Qz۞{4f^  8q Ba>wbo|uwyAA`V! b3 1=Feap `mN z:vo֡d'J ji4{FBW$z)>O O5V~ '-( . s& fZdwͯy!qۚ/N݄iM#Z3&IL6^cm׉_uA_ޠ# ,q9VQ"r9+uQfT @WQz; U `o1i7W]p_~$~_64qx>v4 x[.5! B|ypuWBRq\qԗI0B!"kw'}̳T:~VޅuU8߃-nڷnW{ Ԏ 6m5$YIIix5JIJ9rmOmkr5ߗkǗ.lɈ1USCyq31H\]ծW߶*rywSa _{\~ \rKb1X)$UҊ Ւ݆2bI$+=ۛ7Os}NV#bߏVڋ aBՕ{KSd6c>^xW|O6_'#@`V6 7+Jݥl'|Of>'Sͥ#ncŠYf,$:| 5bx\DA)G{Tec꯼z|YIIj10lD )͵ȳ$))dXCE u ttp=C-jj f$&$&&&v7c_csh8g}6yKd!*;Qc*EJuEΡ-"$`Yekn^w9~ڂ/o+Ο,5jZB77Wϱp轸eiz/1zǤo.|,* IL~+?Ң)31B[s@ 3!;D "g)'Y$#D5q ?aH ̨d.zz3pGS]F-01 z AH )2 iHV:uQ0,ZybJZƲ-ݛͶ[wG;DP-#miOUܤ ßN1M 1>0l FwpNJ`r= z[ƹQZA$8-n'Ǔ.Ly1cv;&]q}V:j B>؀~Y3(u֮3α;wmul_`dkI{]FuY& 09< r|?%S~Y('3ВxtL7N-zU݁2R׼",0À6<#*/8zGT3,xJl׽=\&IرAndqKI1e l >x2=Z8pyrr9*u>)WB`^)y b@Kkht<zX02gM4uC;K]wt_EpjnK)c 07iQk.Tջ8nJe;{7Cbé M 5-O7SѶ.SKsr\ٹЪ+"fb2[t=>"79fj{ÿf!BlS6̷ l!Ys qF .:Ύ,망,kz@ C$Ƞ1(/UD-MmXJqiaP[Cxqz̫,Y( . TJ~ $ C.ow<v''aoKJf tW0".Wg1 8q&6۞/ʵN`c~wR({z?{:WDIU~cmf^pȱ{16@p뷺y/V,tE㏦3I{GT ֯o05,Ha13].B(d%̫ažc3lwC_{E' ].\=?3/f>Sg#82xH2?-iӶ|͔ˆZЃ:e%,$zè Dk|G>a .]gϝ |Ո{wxr8W9\F Pǡk$[6F+Uŝ,^:!&}}zWSvƇ)dK+hirTo]Ԯ˻/Adg Rq rCb-_i -/qG22ҎKɓݿgRh"5$?CNC)"a:V/4-Ia4P/R; C 8i̠7>yjj#{L@AU) t$bn F|tO,:ì٫6p]/s<dEn(:"0FCPS d3^džlHM/@K0BTlNidh.ǔEh{AHy6U 40@}TJndD@[YܴtH+ 8jbG3X".B@|" ˉ7&Fb`u g"̾isr7.Kj`\aa2`ެZs ,rY4tdaAWz_Pm7ű67v C7T<O\aS_"h0j`ȃuB3 jT5X3cjbRG|82 0+8_|zKK"Ɓ(IMڤ7}V~Y_r AYۏ^(yggDI׾n81FOecL :wΤKu;JQ vSs{@>C!%̣  {-8lY B;![ 3.1gTOG潪|7j+Eʇ4;~yZzV! YfK}zMCd{/o˸)UP7snh^L\~F}M8=!GeЯHEԾh`EBչ8S螷~,*CIO,'%_~L hp5?\{Mxi7hC 㻒XCUg7 <6cyB)7.;_8zloGv1x KrU}^KtW|EꔼڠHΕah/MG<)8'xwu՜oƒ>K+=?WRV(tBe?]p@= (@@%@ЃQ `N1Η'eȧt`x.4am7}'Z 6L0o!! ܗ$`ϻNnn[DKRLA6;p@,ڧU)*=,<~FFώ^1Dv|t7jxkA}0 7ڢd~0KtΝZiʆf8h%)[[Nb% 5DٷJ {¥Xajכ6իص<{8"ATka$AFdYG壈mQ<ʵ$e7972 l,n%*׫vX@A=$* 2eiJv,'Fz8]~ږH:U]YNeIJ&\NbdkƟjo Y'ꉇZ K2c@0a1|v goB GB*um2:4MŬ8A x&P؆WKK5^ scK9۳ $v.U*xؖdpDݥbsXxg;ô{WPdt9'+F7b򝾃' m*zg߼17'I\Qގg);q^ebl=_%˷6>"<"`oOfz x@FQ-}P7ݕ-&Z }1o6Ҩ\dAթBIwY%|3,vz m6 ! !ÿ YA V 裾䀊DE.v^i-֠*K2_K?S%v"Djd%ezzƈeLO꽶^Y,+cQFy^)ʱ(!r '=+#/s8Ԋh&sMxx8dgxd pqGH4&ݘɣTz:}FޫI90F8B꺶ֱ*dZ\X!u>YqoX: Ϫ&M@-iM- 5 l h gdb4 w ,LQ==7)<1>8 ĸl4@9~@=Gr}/c_tvJmc/?1:_d.C@:κ20K#*w-GVf2ډ*RÃh3~#׳v;Nh? ~#ΟQX a_Ə/a$"'Xۓi톥_ORu?b_U`G4C<^7Ȏ -6YOI%DQU)a+!Ъ5lakYY@*Әhs@O5i'*Id_p5N(3I)3'_=HzPxl0? aq>;-|[ǙFQ)X4&N]szɐ, RtWzM)#uς#c?})WJf~Ͱ:ɿyRapٚŷs7u2pIԶ8lNya7| GN2id_'*_5[ǫuk~ɮ{S>LAu>s҃c17MOm\q7}CwV}+kSݞΦ auhej}gO U CD^rpuKͧX\pv0 EXT2}O@n7EuO8!5+&P:IkZZ79I@R>"ݎ&0f>,Aa bR83<* <3e0Sw62#L'* y}|!ݿ`Qx.ٖI/jf SXлXǘxBH /<,[4ut/ju4[a[2*I \#grwm祧kBğhV gIjL!z#)bR}jqނV36o7zs)-R`9C`R`BY2R,G~YaYґ jH5@PG{_u/8Ҷr+;5wߜsͷtz>> pRn7܏)_tIVg.ӝx>ߌ3/LK,q(].wNLS}[f Ńsfl34^ 5Ea:FSߐ:K+$۳nas? 8=8=gW:|]gҘ2Ou,t8!_m#c#cc%wXRӳc ZuO+ ch!9%âĦ hSd丽}־lqFH>OҩⶓAlf^ږB BvIf20-s,-QHW]U*ӠBÇACuA~kް;nmmmNDxߨn'IqR K?W,GMgPNj/u(ErWsݴ9ƳM.|7~lEEGkcx2\PoXWlOl29"mj*^ )e#wD-JXk-($';st&8$>EWqյ Ne6B։ߟ@>KJbYy~n?WxM6Qu!dXGM~>ǦFLL'$}ʂ2%g,`'"gZ5/_;Z*_`KX|0;ںK]'{8?rRx@Yϟ&-cKɣ,> wm{&`SSڬ^C̑cvHQE;Ä7<9_nTm{}_崱o,SSKftP0Py*ybx% \@^uBŽTau4n. 폚ↇ<Ʌ:  ͻwA<.DwnM1⿋I V7nܟ[m-~o,z&& vl"ųK0:X-*6 )'>m37, w9eį;:{)MvE8/ $,%]/ѻް`PS'P-ZE%KbK$1PC\8:oԱyٻ_풏nl,~)$``vgoϤ KCrNFGeMG+T*q3*"ۮtYW`h>,a(kH[- N\}f0BLgSΘ:!G+忦 _k  r1^F/͵T٤  sVrs &"()aSN dsOt/ fz}Ni-T*1vCnRfӡd"ws8#Jp`UwD/g]kt'y;m\},DڢHzVÈVe^ cʢ⻍b䧋闥u>$i\jc;90xvt1_0(eoL'\frSrV>II&.Cwzӝ3˖5k2ݢ9O6@j)~}<0_g*=&&_x6BjҬZ@¬P~]UДW|+:ΨUEE")>7^󟏹Ӻ6zk?Lm͖M NKŏH"y{1K _N dg?|Z?Y; Wsp%7'::=+cĄo8\9 G_m&/i~'OCNWG3#֥_Ϸsދ{Ffy<ݯWr_φ/].n;?m}~_?CxcvO?~ϣ?/y?_~~B;PDќ>l/;*$*[-OBA' |G폧~؄'`(-r[ G[ƃhX\hBXb K+$kL˕};~8xhA[$y™uJYP:rUPBpe9E+D P0c0%|LoVSYa6}(w.#v񚻿בٵn̞wh6N1NT &m nVֵm>T MfnǦন#ns8lTd$gk=Hz(%1 WC˰l 7<8}- `rn}|~OPikZ0`Y ׼s;uQzН 7Pt;b8n)gAmS8pDTc#r{`څ9 h_Y3hƺY2j9_9PdA6C_`#A~ddqsBSIElZV[}/Kzn?k}|76Y|U ]a 6?xt䝳*ԈdB!J3 7WK)7%hlmswƾy|JHCI^U1Z_GqخCTN4wf9>}bU: q1R#:ngKL'>|SUv:y-(TF-FCQ/n>B |?"`g :>9U# 0ptBM]MWv`7cRk4ueZJh :jo3Q][FJe?=!_7XBKXl:]:sw lWMWݺ ]իjV}a0Fmׇv@o$}}LU'GQۧ29& W1˩p~wNI} k \>IW=hfD_"/5IJw?+ҁdl)6~M|&is}T^5]^ۚ};غh+ٻ:kSffUJ^ׄkz/ف%?:ql}r=FC="k:,oaETC } c.JkN:ëL^9(|tԤ ťKkK.NC<x̚#c&[J|zIp *)DҹWnզKmW4OL|]@8cO(Ϳnl}/; JX4肘H _%VkϒtiM(ϲǻKl{kiaƯE|!{roK桀/(t\n2[3ɚ`$#Sf@@rzæb:Fߋg3Q8ʑlObt>_QEhEe\@HȦlUrIg;Gyz}' }- 6"wۚ9?8͞{QL3.>p6lUB3ۓƋGHZ>"N%`Rc_^Q1n+@iXE,w7M]o n_5;DpV{sĔS9/5?P78*O*<2 a7MRs>_Yvs @A¢asxMI\ntFo-'-XE,6XI6<uOodpدG+kpF.s{r=+:xVLq}s h^<^>T%=86Rb@b#?KV&ex7t~R#XK&&7p5{41wԪ[ԬjV4;]jM=*VBC@sغͻkЗ: cqf(+pQE+v%Osn0[9g{]t=0]׼tS}MMWӱI-˟om7z&gaoPIqfɯ'GS2CM$HZ5R58!lXjyGPzgK_کe7,7>?~c38NK~77Gs+j+AjA4rHM]1Z^3&՝S#m|+ 0>F2ON'F )J'dVީzwnaߢӏ?]{XUwslsC`N ^ެz 9NVK`|sWx=5x0"caO&ms9UXT){RUVB>}`bIC-VPz_ZD䬽go6~= HM((} \R/JmV5,vC'~YVoOз>2yc]=lBzӶ=UĔ($Eqg>uUJxR  %\}E-9h3[A@R8g>gDM3-ڪ%X. 0J5.f/ȉ[|}3x3ⴉ۔ʢ {9̎m;iލI/-h%4 kKx -iīeK/,j:xD MԶ!0 ߁D_:ff߈5{(K3dL XL$HuT/2+U5_bRqB XP ~{P1H3*!jlڄ'J@/%<zIqXD;pD^ӛC"B`٣j)USSe\ZEPܵ/]st3f0VjFr/`77x@+7ȣaH&<:ˠh>jbS%QR+xQJ"E0_j4{=RMډ `o>3 @q;G P|rqHTiRx0ݜ 1e)T<6wc31?"@xS"%j?P_1}m{JdAeͻ Pǫ[K*2*"_VcJegNs;9ӹЧ/Sd mb6CqixV@ K7AoNp>9,7&z[:{bGX@@fVjMǾYg}Р:($: egGAt!.0LI~.2DP4Z'2V3@(DDŽh`hkjNDsW^;nƠ^%J΋?jή; :P+g65YpBHkq:>+,ja߉! |lKjذ(g*iVJT4eLKSjAUptH@/֥]EիrjzqI'$7[tVKQH){^2I( ;΋-ܽ@þˆF]dԷlZR]iR,Glov'Mn,S{+UM}  TU9}[hR7UEgRt/aZy R m\:>8E= G5@揵!qEH쎟G0N9k' 3ʽ_"\dDUsݙ\b2OaDu_tH:j,jlUODYrp*`"@g"4/jJz;.g=vߚoz]`퐸MCxCWIcĐN[.<wp- ҄+cb;`%Q:"z !ަcMLy[ݡrg"Hn GtE0Uk !aPCgz0[{k_\#!. .$e 2]v,:( +%%Y[[Ij] 69Fcā۷luyQWAmd z9Z<.ϦYˀpkdjb3r#5d9S01PYGPB~YD\r6#:͕^L'F $@1:B3@o.*1vUis-MEc M;Dإm8Ul"1ftk\Kue<vW|;oCC;@G0ah3,B&^Jwig?a@@PwB S')ԳUo:e 7" C*HΖ#P wʖt8&&5.nxd|pg;5.bѪ]V#Aب5`)H`A2۪^*|>C293; !q> 1Szmh+I"*0f=FHx]ȾLC"tLAbl](٫&ŝbwWe@b!x'@r6 % fz$.:~{u*x3.F@HQJHw;4(2rOq0 "LhY oHx&$F UEY% T]- .z^@IDvoc ޷b Ji: ԸDs-J*&6\TSvV88D(QUɲܣk^3-)aD I Cj VSx& GD%YiGTu9s=PQ$&Pȩ&uC;+P"0#4F^6vjxigN1RCv$#JD{q`G^?m-)dVE Sd ^%UU%RF8$ /dy) Uxʘк @)@Q]+v<:`{D"! HdjTeA !m+dBiPT3R@v]EX0(T@d X~ߚ~[:,5ۉmK%\2i"H.pOSx`ardKW $~LQ)7䤂ʎ+:C`Qr̠MIE#?lݮ_gWVk][wKR[nj;렙Bzj;t VZ*6j?N̞֡|o]N%.pƆnfp X( DeN)sŲ[r<ڝ'Dw@dw57X:gCǖEgP;z}M_ʐeziox-WytT.vfN#Q\t~Y;ӝZ_o~?+Itڏg+=ۣz^.wr'|<ϝ?_ﯧd@Loһ-X(aD!$4![([ `C-clvHm---lKLL*4撐DHܿC\uc>7iur|b5Ә GAh;$R!CC:fZIg$nJ ,/Wܗ!8woAUP/ #T`(Hߥ>YqtmzZ" D|`UŐ(I69,g\RLHn'E uWSQ']#XAe(WZ`HҺs:,quJ_FXcdTˢͻ]$YYefvڵ-3kvծvYp29\ Da qPʔUչv]ߞ;ޥǐ KHAPcԺΠtr>vQ 8]ĩN'm9 wݧeKjpmn;'98S(]\NW8vG:':r'Nt9DSlםU !B-BdUj5ţw+J 'Af--ݬ$\U3q>\n;OI)A`E*Q7"͡E,͒fmq} *NzLRpv'I=|ل?SἈ!viy'aKY:vRf`םvw 5G!=*2 zy 3LK陣z2X#g1@s>ٮ |A )[Q*갻90j)?O|_Zo9g Jf!ʘJv8tQYOu&$0m%<:lxԱdy־ߴVk;\g}*αëjv?iq- h>mrva~KȦc$lwu[9?r'HU`""+zK0؁[-ҫDab0AWt$@[wn`bG)!,!-.Dfk&x>FEź tEg>ad d!{Gus(8{-~%a%f3q|qq|=>::3}y _Osh&*["eoU&7.&`;WhHgaZ,jMp˹Ht ĩ˹8Xlv CX P9ެQ> ?1AY&SYzڄ<⨝fl{ܹޝw[YO||++`:2{nvOj-ۑsPxN}qvz>,}WBhe_]|/{]۵^ z޻+6 dBJ;zW>#Z=͓s;[;n;G ]ٺ[WBnwj7wv޸GFAc%˽:9%hл9AJR@z憇AK5]){Gtez=w۹`w{X{3-FN(RjX>_#(h}hc@$($P$@ @PB6p<"qyxϾ׆ GX46bDLiiH+3H6۰8kDh@&  قl 64VnPbԪU z@O{9=iwt]fJ ]kP)o6F7;ʺvWnv={BW}/S@hAJ^W{gQE{ #ϠҾ*>IƟyM.;ӹz^(VYG[m[ZjSPAByZϮTP*I()yIdnChBHH} RL䳻SrDQ:T\ӦbU `2>}S{}hKq# &׵dSk_w^`>]%ֵVfRm{ؘ=u>jeׁ:'{Kxwg[VFfz٪jld-[^ۄϼm<c,}W}8PS<l w&t<-Dn}y}8&ctݚ =uCNJ`P@ LM2@0&4Ѡh &SAMɐ4@C@B`6&ѡ=2f)SF'OF 4ʞS @ h 4M?|>΄QpPOG{߰tB8B2B2p6 Wʘ&G_4Qca qȚB7I8y9 / (9|dm ZY4'a'Y0TlY!\!d ~Z}@a:;v:at S e"Ƞz4ۃ7 JH78Np헣]7WLiVm,5$\ 5=9'bFҵ֡#?hm+~P{1}l?cϘVIGps1UlR 3|Q](H}+b/8Ro1w]D GQD 2_J^|FU.2"ìԥ-ap Qiut){5P]:^;[V {5 ꛙt݈TgHujgڊȯv;e@pTʨ yܼ<l(߄Eҕa\icϩZi%P"$2ybVC99z [W҈N_d~[} 0mԧ3v`Wy9 ! ;t)[?M~Ul+Dj&VcBFjLɑDDLHOU{Z(u?8_R70Jn6Hb&>FRdT1 aA`݈x/@h m)Qt4di I/-l=(Vֹ)q {.csIaQHy80ocbzӉ=h+qK{I(U&U;ۚY:HȗM|d-HLpƬ5 A 2id}4O c.s20ʤ$͕M{iɽ*p8`D.d,x0$kԯDEZkEMK-Eշc=/ytsYw/.ZīL]=L{O$煻頱) "dex%\*=F b ȸiHs4Z& /!{bvtJR,ć_NzK9A& z0b(ْ=%zsPg $Uvn©wvR(tg{} Ϣ(囡m-$W *AtD-Llje8,A" LJ,ĄRFDdFE,ˮw*Vp^67mC}iȌ qLB!" j5*h&4BA2a rPrR S)dR)& YX `h_MyP(Ec%;/iU; 8U{Hאm4[<L@! Eϐ b8oxSNH|{$ɆJWqƣKmL{dV& &8&#ibO1T *Aifݍ-LL!EhxV*nM`guCrheaRiHn3suڎ `.QunjT-N9E>`+Q2KZƅz竫Xpd!ID#Y"k!G 5)Nn*<@VW-Zj f$@T@#Đc 3[JPR0Q0t7b ܽ_uRgA(AJ`II#km@$|n"52mb;rXižVF\YYRKO>tX]gUD~i!d&c#rQa(|OV"n~c`F0OmHܛ2HR2yK$ .L[y:,bTJC%sV-!0oi[Y%U&صk͝uhJBET+xRe@:cͪp^qM,7)jgy 8]'/6<#z Х-)mŏ __aLCقGFkd3|fO7ū{Tt^lbHDFu}Ʋ6lU@x@̐AUcDӂnvS[bh!`x画7Gu?1\Z3rY$tH@EIq8,!P H+a=YqgXh<:A{]RBѧo=fG+9o_ zVhnF;p2eRA]YkQceĽIn`pO*ԖA)JS>B_J]CvpUS" pԆq*,oG[E=ME/!8"0ot+GWXBq -TdĮ9_#e #y0K 6]00"Oes+98#RO*x-vfrJǼ9"K?ԬBWJ}#0Ϗ3rM/<7%xmbˡ _W֍p/m ۸_Vې6IZ2zmKU\{ "l~C. C=F y}nm:/%BF(41ciuq$CJfG^Q @Pf8kɏ\,;U6upL:A4x:/(\i.=\Bk J2ZzdWjlmBb,FBVçn%Y1v f}ZCeFg,V*eHR D δ,KJL2CR+8-r D$F bwZpL!C͓A$ZGMG;$D@mH\q.dVg Hz,OOq*Ҧ #fX4߭7;Y0j|'LRR=jnYp~#Y_7\ |V^SӵAہB|L8BJ[E'97PLEhJ(SPmK .7ϫ=wPg DHbCf4(@.*M{0/7NQ60jSd0lo0y87=J̴@3k/D[=a-}ElkE.n]R`*^.&.=~m H|sՕn_']:L;a63yl|YVZé=9? 5]o|WTK0&C~:Fn992/P|MdTSR_n~&Ҹې~GEoSy\(;y9cmfNJ>!C.ú16EW\=P,V0 s@w@DD6qOY 矛~>nhAߘODV7Qӏň$!yK/sSk|,ϫOpD-29:]f <_aOv1Pf}FeDo~"So{M=+0FCh߽qMsP$!acr"tϑ xhBmHmԂ22 $☢5N đ3%ٜDvH=S~-6Ղban?{z{ItQ96K,?A~`& T v8b\өdjd# v\Q܉ 8CTC`&U8p*WjV(4-ݽ.Ưj淃̄<]E1J3#`t w͟h^R8UP >|lh: ͐n#^dߠO"CJ~*X'+=N~~nB3t18MGL'glpP\@  ) rLA6fε v$%@o<Ohߖzk v1 M Iusgx,.T;"a%IߎNppo89䆌¶&ުsA5]ZH/C@A$s-zc5)]Adm*:J\Ś~oI&H{\!H-H$1W%΂m׺) 6:k EN'!|碮rQ9N)ow>'JV-8%J<3pDy5nזVz,h5`Ijd>4#ʸcK"km^zL~eH&( VBxT d3Za)Jn}_r:z;-) +c*5)0]J5HCJOi?-LaĘ UɇRHȊEDTDADUp|.MVGס)yHTNUI90)1dS%Jd<3;,}twVdIs_OR4Қi7;JC2nUkK`%58F2mP.V8tU Ea=2s!g;}_zCnm)ƄI>,7B aKdjQ"Yw8SMh܇zvz3??8!?] JEB-n'ș(ϻ*l ]4J".C 4rƪB<_3U!:/Gh2C i4: ,$Q)3,CfUM o{D 7יGDPڳU"H~1K={Q1Q)dG`@ &"V}x"xiG`#ڂmootk/(Ƣ3O.gRpx-xqj33DL&NxD_qL{oWmM֍ y(&u/C|E_w_4:WU da ~$kb27|JBf9E\q/M5wA 7NIbC jynBlY]GKaL!zPC0-UY뜞ڧiB4!4O]wp^t;i@aIV",aRRIVpTVo UTňƣ|%oejJedRR d7<_jzzY{)Yѓ "W=w>~7;r0.|/m=c7mHcz$F2RAGgۙ.UQA?y:Oܿb=7`"!tk! 怈c5 Qt1娚ݣek{Wm'a2}2)?{rK| \BD CJb<hbDO>Xh0!\S+- G75|ͧlڐP h{H0. Yؗ~4\X6qmoCmD8H*W:L͟](?),)dil^ ?sa N iaiG0q-h+4%;&ފyiA/@'_H_yJ+?PkP{=M$-[97m4.{2x:P Ӷ?XY#LsC;8x<1~wiɸJΑ2qOmul+H1ڧE!C@NmR5k h;#XLq?^I\m9RD؅#Z:.v5!&|/׍r_a_m؇%)UYw:㻛:wt'/7p"LFHj36y4I}iY%~ $N x*JsE >P/vF &@BLH#J ]_87B8ga' wgH$IݺI[x˘t3nC n)W7f:..su7a) 1K)t2»Eu峷g~|ChtOe1>zP_>A¤E/bK8P3D:lr2o~MW3Mr-$ Ƣ.vжPK?z`Eb'  n]Ɵ{Xy[D4(RF]$nsq6Omze;~uMi{U͏pSwWX]I\gcNgCPS7@9qf7+g#iZ[fX?\w=Z%̂LNJƬT`CPDE~]E 2%i8RUyŋ!C\z`}QL8Dse<)03\ F3zbEuX}L-vX_*6AyG!bڴ[ DghnزzPT)%Vec(}-,N!6 T)$)X%|dIH @EL"9Ó2>i])ܭ-uEZܱi4O_.eS. _~`whk~XK"g,vpWh4jysKnq>.xuъM]k8rS.Lf2* v6aA}c_U7_H}^O(L m|J xl*; tz\"nwDW~qٿzwȗ׻q!?Ϝә1hATKg^#8}FXӟWlAEᡴǁA >hp [M0ycAJKc``fP.]l.6=>A@nq|G|H0`tFC J Edttq=cnab ʕzģI7JgtZy5.Um#onĪr!s>K|CQNII TD*E|bFzP{am>ӥЧC@ ` u& Ef+b a.slyۊ.$!u>OՕu'.3)ACpr1Š@eT*%S;mHq۹.:EMeez M_^F  Xɶ6,)QEPBQBG28~ ׋uT^k JD8V4X(Ck9fg"48g ޅuJ׍:6F~|/bGv'гE8'ֻNJwiIڽw+ _$4 5&:Za[Κl(i{; t`1f 1YZz3gn"tuNIJh=+C'HI"#"$#! n]cg;%2y 'Q4e \I}= ^ZŨ'=(Za`5%C7],q{k@=^eG BVŌ}+14$ N$e~xphX5j?!0qNoݟ9_}55KpYo6v׽ KO/?wխB~~)"AHg?YQI1K;5VOJ}W}0A.oι$b`c)*J2ԆR5zݹoH # FoSApI;|_=QBwiczD65ӄV($GX6G9`$s@j R1uQOwhxh!Yx"B!q)d~|{2[р&iHiHa3DQ1j4 A;v.{a 4/AN|`ե`]ew0;Q@ "~iB=;8{_GaƳ1Bkͳu'"K֏ҕKWseIfD LM1qjJt#[=B4,T>I*g1n׶T䞧QNOϞnuTG]ؘi#^Dy?//z/2E%Up;PIA GXyFuW&Pw#02[l BZ2hj#x`y4t ]{"V4ôP,Ԅ+BDGHw~m;R$&ܦpΊVkPVh=ٿ.j2`Th*.i~B\UʭHD ؼ4$yaiG_p;1Ņ M+Ӟq2Nx|M8hV5J[`3\ha`qU@ol,vj1d&z 7Z*.zG׽y&<– hݧ$2b2!bY-[ZcOε~7k.﫛эtZ'ݮ4]BHBX(V kvBlJ$) G͌ˑ$º*~Cذ$;~"' $Z“77՛LB`J@CgPHP@ )ac[(-ø(?]) -}#{0x cॆ _JyΤHoT5FeAXOސB˖iT;Zmߤ?`zF窟{χ;""Y*r11pj?!ߏNسg`K#dI ,ik _-2my_ Ы,c :xC@20]ۂApB Nv+`XAsz#t w)͍,n 7K)0ssATiqg)V e> uB#@o*~__rpPA^EOe)Kf>b1{Ft $|.>:. 1y~DB~e!ՍW:ƕS$R $;{Y|otVCjHK`d~2F#omIkL^U|ͅ7+v!gna t` "!BWViU!eGWFt0QۨvgC͋+2(_ l((0e%xZ3F-OqörCN3!  Cql:ܬhnbƍ{!97Tk <ꇕjWغa$ODCV]ɥǍZ(PYDNQ i:^l-4x{]SѠя";E<^"Ngwܓܪ3g&OQ͛',S`f}<V&R!hHHGV\k<ѫ?T ԥTgn\ӊ%L%gUV8TrtAº,`-!7R!Y+Ifsk#% Ӂj[w#m&iY@O9] [q$:xTlvU ` *sJUK4DHU9bdЪraIאC t&1WpuajsyS0L@#B2Zc}b=fv&VV0ŠvAx%)Ê%[j>@U4AG'[aNP-0MeLg>̌1zbo@ZlK;QC:؉+M|S6ђώ !ӭJRf(8n92HxGw2=,х ̩ htn]´ȌMKn6ݷlexɈ,<8+B pT':5=;8P%NI0I\SPbs]MEJ&n E 3E\ҌqPp͜9Lt ɂ$˸Y;WOr8/o:3CTZ㾎(R):X"W<7FuMSH%kPGBiY!'Z1}ˊ:P1O~7O&ȧʟyMC&=Nwu,1ߞ[uLu/ K )G64)婡T-vzDߛv2o%i´ѺAs $`+pcN+ӛffN"!N`(ڨ.7ilN4į~Tg, lٍm,VF8&dfJZ,,Q }c)PDq0d,&1KXDWQzq.ok[vs{z;uNIonA"i0#n|a⻂[P,DVu|r1@b\g7cO1MN"&24MP,8pE4nCP>M7I&a`X8 <3J#!J[%,ң\Aro'2S[X=Ý]V_+| u7ǂI0a4 /O—gԗCGW2I ڗO0TU"\x8[]%= {`bBέ oL"etR^{WC'@jNҒϥ3̱ﾊǎTR9q*܎]C @†Z5f&jhA' O)ޣ:슮=2j˜I[[+o Q"(J1g[)Eo)*$ASUfraD(ؒPZ1hus*rPg@_#R@|B;|h0gȤH%-I򭦸\IN({c$ Br=a3ᇥ>0͘箋'jGv a99kiXbeHUk"eEtuVz$eJi&Nϫxza$~əw\A8UN:*Jg]&0}/BE$В 8Ov >Jݵɋn-K%JMzhGZ_v6L7t&ЧJ!$ G/0PSc(b $o8n[7ĺtOX@LzPsx~+߀Raf綀gw>'ifb>?D# ?owk%eAb1""4=+(E0>tƯU#P>&\&@΀ ؞NA,MC|M)y“C/:*13WcoA"$jՅ#̨wz鄇h=E8~GybB(;dD7:ubcz)IʥY69HE0w |_>n9&dǯ;EBy|S䛎z?G9AG ~D˨$ْJUaZ cg'^뫛C?tt iGJj?wW{Q'6pt9@FHX09?G(|<׷R%35-0b,Mo#g{96S 9fԨ ;ru^* x #izgZ#!@7y)E ZYfcgCq~L3i*5eNv~Uj.1DV3y20,x #%V|/-y aV|~o/%rnrey[ 47rֱ2b!łҙ#6T"-PiG=uBMHLJ c<~ܔ3U85$z.-M\JNAbPJ#'!0=U 0iʩŇ^"$J{7N_b%Ul-)3óJ>RH8l rF P)[6쉉1g#!0L#D!ϲy&rLSęL8{Cy8pi Io`ӳn  +i&$DRS3]ov[\m tq)<. ) ?:BiKԜ!eLHPy[z]MloW0Mfz(3stp:jE1ADP a }mM@GqhIQ% ,hO>CpPg,Krӊ@X8 o=#t 7j%V!*nӤbJ.2$0" UΠ(Nb:xPՓ9mKc{^sKo("{)s[e!)IHfKEɼ9-I `T+1`X"mȯ8#!*EQ2R|[vZlVkwr`PAdbj%#a85 0UJV&5ezrSI#>rBHSeFX\RH0T Ҥ2Ca C3S*PIxP@S(K{VsNTEɻqC1.P!"&cS\$x+;:+%C5au{8@akо=nU'z)5^lbz!li{#p  ,Z%8 v54eQ&X""(2KEZqc٭$ h kR\2oj4d0EPWU*@ι3.#SǙ( /F%cZr!qZޫ;b9#@# 1ңj߾pCwJkLRE ~ @&K5-|YUi S%HcFXAA ⚢(߀ȲVu4W&R*)8rK?=a<1A>>&7Mݧ FEY}J,;[]Go?ƣ+,)ƤzB<8["pTx bآ2ybHן:\4K(nhO﫫3R9s#0^>d/Tr2Oo;_5'nlxܤy+ի_%D -''MPX| 386$җ+4 #)HAÐ +rgd(K1Q8H j79R*;o E@,KNHLOh \9 C L`g_<*xxN Pj6i LE 1;]ͅCfπ^4梛j&H{\͗s.O\`"8,ɟ̮+O a i?g}PҸ ni,]uՊzB:dNAD-=T?~g1%LҒ; uwQ|Z2U6dgK34ib8Ⱦ vFn߶z)ZSc.ۆ :{xaa]KfU dYgP HXqW.q(C. P2B)hZ :ޫ^xv,I<%lMI\zfy<7x5ȉw#5 DWUŸNpQ|S4oN4ݣ,|ꣳ>M.M9HY $=.Q9zdtgBW1 S5muTaB@q?EοWcWu?7Ks9SngbW`"R FIe\RK,Fx^>+ka? [\$Fr$@P ѶbHQ_6'20tϿ ObpPx̦91fݮ~>q#| t٥.,ίoi;=]mAфВAZyZivV{aޙR992IB /ǐQ苘iAWPn 8Fj`\Dܰ6hlԮlXPK q|&d Ρch} 8B+9]ekwapD-W) ކ蓅MSZ.T>Gf )+!줘τ9?`bV}jZOZഗ- -tu $.+.+o:ѱT_˗R@1s>kb:[0O@Lic1tϳbcĘ$'7Ή78l<{\tc8 36=4vhu#QL]LQai95&Exwh$xӲ/O,I$,aklbm9t@oE>$!B* zBh{9KE4}|7Y=nJƂxz6G(uqg[XFR 2Xq -UcwFdr2],;u$ʊ)-ɹm 4|yPFVA˘#L2DIx7OHu"PG<|ns/ ]y| ƂM$xhUBc,чyp;sB gJX32L1D{hGႨPmr`xXS%)Deuݡ8&6gWq`hʋE%R;Y jxkgdžIgE}Yc0aHFbr̒YvE5Wq6#Xˊxr#yZsH1o4vK%&&T b!kf8SN %4DMTE3!Yt J3&i3HZA2H͊/4g7A $j|.8BaNiWwZ]#م5KmY^O7+&c<ԇm1[jgiql\*˫;ڸ˥CMd 6AEHL.)T3Q A,6XWp2ƶD9X>p8gq}za= ^"w6 , x@É2[sAM[jIŠ[$qLdSȪ['axcKnMq6T:Vjo[3ll?(gLc=k6.bRfhe쀄=#mz)D7q% P*GUNWἯ;V~UG# VS\6OQmV{Uft(maQ xy%:f" vl+RPlm6*\̱uj /1Uu{6I v)YlqSRXXբ0 lI/>Kw{$(+u)*% 1,î*г zp?}g۳3r8&!2WIZ>C},,0:IU9JRlyyHw ^oؚ/wIm{:lT1ҿLCj3JtacMyII7V)m܈8=yXqrBpbGBu7~#NCלGUJ[_A4vܵMBY pI]K.l%"+Y]ފ1%/oPH<{lzIreQ91fd 2NrY 2d7g(Go׽<2$KULb#>-뽋Q ɠ\,》h4>шou!0Ja޶kɴPﲪqUI+6Db8| [-]KdYpạECY~}(ωG$ ~u$4չ*w"EƊ>im Mdtڰ_spרq[ԌF\$a"@q F`R 6B,N_zI"odXtm$E `T0ALsHm.~}opO'fUGؽbE$]^y8o?xJq:?#E 9x?EW.`u@}vDL HzGj}Ʋ}}=Y|^A~<"]YS@o4Qq'\IJG)]aQnUܕ;UtHu D*|68ͯ6h,!'cbIE; L&!'WzM\BYExs5^5)%pNͧgzŢ 'e"|W'E,<_2 ) LOX垐:-S:?py3%4)&f$a@)=@%>\Z%|xDט)V'PV~M7JD)]%?"b]80f!P׺p@M+U\BL }z󟓏D-di2!3ǙxkIpfsw7EO^m64:Qf~~t]9*ïb4Et9m;gF]ڜI|)^L85.p!)R.ᚥ(ׅv@P;>幧^MlkD4|,qLf6l-Q6DZ6Ќec;$G#a_xi)]d'rؤp C'f͒P ̵D$Ȫ=NIJ4NcP^I;}j ^;86X_FSf #44kT`!+W%KRT;TؼW;NÂG GdR$vTNgб3u էU*O~F?*OmglXuJF_ :0>RUiQ~g4U(nnzb\+=ց: [縱7OBX߫{S4[Mx?kz٩ՁiH#x.rb~+[뎙ckxl8CxzHCYFϛ[mXcy[a}5"CĭFs{Xp)mf׻㨷6T!1fF7Fe hOllQ`k9OpyjwN[ga5˧GF&&vvU -aA7Cf227{#}54kcI ڠG?nשAlRb0PƵn!SI cwcF<ЩS:z!*AH2I^cm~rJ:5sQ_ȽҞ<'rg"9 ͙e%2MUݽkjXpHz0I sciicZ`Û5 vցZfZt0$@;y) 3Xi0S-G2F%9is4KL֬UV͟ot1 f5Hїw#)4@F$Egsݜ .9"c}a5&߸QB:DIB,;lS9NON;NueڽKe)Ug$IaJ--4vi[UlCyTy;/My.[9&.f:Q}1~orC1(ʋj2- G#s%Ib}/4PcT(2P@Gg5Nju l-.pxEd*cD\c{AD@9Kӌ[ӎɠI8058JaJ7m} EN⟊WH?a"P_3ÒF/%"EF؛ZwMqMEDϹ/!YRlU zcv1`Ke %^ CQ.% p){ qed.r\ 4 9 HRo515`O#A Ml3˛cJRJa(?Ê$"\Qr9E+ǎ^|Y( _ZjF*}NޮƂ NΤټ_)z_crGV@7f>"$IE#nf嚀m!M\"`z3M/-$MۖN \ѥr&PlEM)T\hBc]״`&1C1@UfWnjΓY3.h6gm,]u%#!T1x \QAe|cZR ޠ\z&~A!>dJB۬DSѤل&Z9hJGW}OTAD(-f (JX^-GNꒂxY#{7dk]VIK_=Q)rU;\h*0"RN`a)jn[x9x4 U3Yź$Tſ;| V%>Eъ (ʯ=tZʛ34=)t'[X:Deh%@7\%;)dKj$%t` ΃S`OR RV6^0bF-16P @HlPE!/fS&aӳ|\pT"9B؝-&/A_Z$V8&قELæ2`R`?X#XS<">I_1r.4Q'>D%ޣlPFy qlXIjqFuLM2)33 xGd ^x)R=R,wdȼ"M?,t (ma2ˊ%wˑrov{1f;C_y7<3:JT< p3\sma|$0r EZqŏ4CO^.\>&TW&OdB@4̪aq~3<dgk޾V3_-84$ba x$vA>8I%6^BBz?^ZmIFCe۾!T[9ȯYBSTn=?+^2bY#g5q{݆}lHtHգSFj 12##Zsc_Dt<>|7]࿜oZZ1ˤ@bFBªZIdd%`7W`=)T{[m'6K#O-H$Y 4&~_ixNJTk"/ O-ף|gb!Kؚ)4k ^U}H5 ~-UU4*,Gzfe3eAuu"}p+D>s[U"27͝D&~tmS^nB ! ('Pov3Q=g\|ɗFG6p4ً0AqTũb !))MLe ǁG"MZ03}7!|?MBtسg=}M/ @(jL&0KS-aECjgC~xK$G/!GeIa\bhڨ *ga?iN0N^ |j#i2dũ%iS3Ÿj֌׫=g5: ē(dA::!O (,ºZw-K\q x"]>԰ҠE y$b+37Uy:jB+R3JD'b0ȟ+\rmJJI,ti10/S%*t_năc=Via&׭X/NUl2? |" S~T۴F# nKT[#˱k:8VV>_i2_-Үth,2F8Lˤٗn$b#Wmc?ӗ_;2ęq|_%SbUdn))|)l&Uw\;I3d[Tv1jC"vӁ'v8ʜ&FJ2Z5@hIra,4]   5 "\]}jJ̜oSHLV"A! 3 Ȳg!G1"h]K5@nE4o~/n ܹFt L FIsA^V5;(A2 H5UKxA2CROb^^ a&JŒҰkYIwn\)sI}r_,yt}]2i[`jQr} lAWs_㹝5 Pt{L(`j[S-09rrF7 dBgCO߸^Ʌemȇ>bJMǑk vIgujF {yyҵ׃]£~} /v%`®қ&%֒9=G[/N"Jk0dt2r*BRb$A3I64_7o]eTl'$ EBnYdJL+L!ugDYXZ J]d2"0KD$s%H1 ʍ=VwiҪu+pN,a[p'PzF%[fɣAkY.*(BBNWʀYpMkiLD`D b8ce{<> A&F\X잵jj/bس+Ln$/|B1`I#њifvqSYJͯ%B 5oۍܙ|7@ZN/]w-`o:bik9 %p$dbKؗ5'Do^17*vNcKc.)R|gW8Y73[S"hNÖ>z;"*tY{oGQIʜ3ByRm@GX1 yͻ98SBb66 cd^_A3xuӀ:; ;q]Od67#?ߊ5LOҦݬˡ1窞Yn=DcdF-a\pY$3|Mc,hᒂqnO}L",C$TS tX!Ґ՞׭)4r#r aw@>JQpd.^1rvy1u~ ޠuOE! .aR7rY 76DLuoyl=ۉ sRJ$qv;i}ShIVL&.D D8e%H$e(a@$]6x޼ NIVAƺmgDc9E@!KmՉK5 Q 2$xZl _Ƿ[Hk8>8_;٭W{֣nkGjt:{5K+_ uYC&0 Ԗ$ D:53#֫5)d -;,f+.R,?XuU5G$ T9CA۴rlϕ1ڽ;MNfDdk7bd"+1Hc ս#v60Dii<-08[%B+̧/9B(.Bo!kĐ[*HеN 7 C!K5EQh@97 TX'`=5Px8*~|g3 dLVFI2<6|Й2)Fd'œ9 ,GkGY! A'0qEUaĂ!.bj1RE, =Z:.]#^w6A&dN?;at=< BmuM_+oݔi87+w5 ;RTI3peҮ(%q %:@En]h, L1_Qi1Tj}NrC`owO2-׃nx=&Q4 F=Y@A*-&rAK(B|}| ^I{L_Tp{{XPi[&({!#Xӫ;KqJRg|I wj8$UTn'p3Cy[ a@ ݍmXP!A-%Wu $ցJϧx:m`*f,W&195XR Hr%x|I ظϦA`Œ)4 ;.w^^[(ثE4Bbo\fDK%IT!_?9a f4VSU Vbx8|,{iĩm%͍,j`(m0! aD;{ҩ˦§ )׋HLꔴЕζ$ܭu3l D\ Vl^5B|v7--l0Rۢ]M&({4:}(xBB#!+Hd$$:3`ٕ\;{hVxkMĄ )#~\ck5ztcw- z2kWH/NebJ=g` m:Je[qb݇.8EA׸0wd)[ >j9>>^F; |sIDrKi푃ˣD18IK;D~Xh9y~W}M3fbI)!&V%$>moL 1F.F&NN.w_aYY۽qωwү/}gjD+zxJE zp Q9N_}+ej0)d;REf 19짯F26P@[VG=%icZ O␊٢.ͷ7pm1tx3-}>^Rh'6#Vb""C]b1>C%P#\q빙<}(yjNqӘ E,7tdg_qp{_ ~\CO_ R4u=y[9Rio>?N:^N[ mVY`{d0P6؍R|t Qt,ݎ/ EI3TfFcߴniH@Te+M c$1ۋZ>1!.U"CM#RA6猱y6x %OhJqyL{3 Ils3{h{@kFVc$Rą4@l|'0<0 [U8@$Y$+K<ڪ_k8xt8nC242O}w`0.XE q*yV@"D vZT2"YYڞ鬳Z>k )w`D ␀@4H}^aU4֎q&ĔS}`]zwA2,kR2*D 5 Rs|G;g ;UT*FAQz bHvUT\ј/6%-oyxZʕLwwUZ8l|#f?"Oʑnky3R5ɥ H9L(P8pmViQY!桉s^eVp 60c"6cW6]dF&ۏӧD!$m$$HI[USgc@vxDOH#ƙe)iBRyˠk^TbG5G7StSl4Z!jނ@B?Noh1zID p%#A-b*T!H"='iP%-=x6,|'yL ɄJ<'(GS,Y R)cC P5HBݰ1 OFX 0ֲ>&3+t(k%4KzfQȆ@C H I"5)dICHV vU.f.T⹮f`pC< HMT_k#M`xd\Q%&j-*  D o/10TeMblLg0-celdBn"|uEgcw"6sXOT02^`JY#+89k^JJIdhN[Z ޱr9[ >~^+6[2R(xl l+8]XޤjeUgUru0ѲN4鴂KgE2jl4H؜,Nb;Zh,m\# d47A}q%KZO|Abb%,J&w+qC=%9)-,K8dD@j@,1мw(/nH'elLl_qn`ı ӟP|fE̴ ) R"r1bdNoܩk6bypB(D@8"$BϔRK0Ui:ZA2C'_Tr<'^rnD%HuJoworڝj4]Ad9s 5)ѩ 8mT6x `{.dz$T *ˊ1U 8{k.-ݔƊnD)4R!LfJ0C|Måsd %L4h篡SO-ԇ$ʯhPIۿK\x!["66c!J룘]la TӠ;CYg/{|lޮH!F^^NrQP(les_\bhk.JoEL(Tkc4;7h#Ɍ0obW+UiڻG\K0$OS/:VU#"Q:Hnm# ot"gv L dfѿ<٠CW#ь'Nٝ}qFAnhBԂn^/]wr`T֭m* u@EfTW2au+Dj_ dT҇D<ؤ"C*l :crPo:Qa!8 掘mҷ7'r&kҝ֘gi&yOAu\%z1RUȩ&$E :! ȡ|aN<,BB䥘<ηҏJ+*&{WUNjgBJe6Zg"Oz`ؖn~٧&I$){Z.^F/ ;1TԔ0c"dRFPikM4t!@zӣͯl{Zw֮cW3)bj#D*_XF9AXiv7v;%\w\L:x$&5U( v+9&ݛީuܙXPݺ!~;cڝἺo3 Qm#R \Oc^i<) J4*x  v~2ԴJ @Wq&|̉XI$Eo~O iƖoͳ+Ŋz ?=5PXZ14d-bt~ϛ8]q&M! ;ML? Z01椷5a477aVlJ|Ni"OyfΛҬztyW"V&ie*<@_ ]Z]iXirH$ x[RŖ<)^>Ac,5,n&솵ʝcNAX:0z=6v6\iHJ~'RcSCyTY d119djh(vS؟ݨwRRxlWz n[rx_3J }t~QDO?`QzQYkHʰ$4ôǺ4$|^/Kb][taH%t;rsS }u:G "C4%aʿ1㫨aS|zIn!!~YYg7rL1xj?t$ `%dÊ'K*APHʐ:ͯ^5N?8ڥdi,6Q}:kDDSJ&`!#v]|OktX*Zs4P#jbhǕxtGǽqtb7Ԥ  PԫB¹U٨c4Aר|z;*\OL9VvHrl*ý4G1ޒ2|; YRQ]ItW ,p `\\s\<$ea-'eIն h׋Tb(0>A,j#]D $ 2``y0v*ד (fU~;r7Ӡ鄔kM`L*D6~ِL:T)aDupڕqaþŶUzN~5 voHFW nEE7 b8O09iCR7dȾjrnW&b+}')ę1Zt>S΍Q&tZKyFniK [^SV dxI9z8_t5GҺJSFMo*Om\1ݟ!R#b!2DDP7= P`/ԧwyMSRW^|CuA+q,̰Ԅ FK$to!@ MVP> y|m,c{ #·5^_Wέ{Yak!B̧IIQvoPyE[v́$ NDڬ >^ςw%W1U tBB)G8$",r$9{}7w{tФDsY=u{8[99U1AT6^xxq,فЫ>l+VM dS4CK 5\V{\Űg˗6godN%z:@,kNnΒ[4oth4e`&X;$'3L]rhթم. @@`LU6UHCDܡU ޖDQdu/!z:g{s,S !X J4dkLQ I2&VԶkӳGæΕي2xxԲ3nHN~ T5%* .u{m  &O6>ʗGGPyt&2)${'?S:OzF,g.Dda$&(6ݒr4>7^zpc2o̤%Pw<}rX+ a "4c˜IFEJ*G[VM6BMH~H⓽nN 3`@Uw 2>$#A!cK9TQ,/mԂrzӷZc\{"q H+bjĐ(naV$kO!^BEަB ߏ"VFYP R`0'M!l>P 814,xuؗ#O2me.!lCߵD{d=mȋ-me<̧d9a^P!;M@beLyVb]ֿ Qvn@2;I r<‡;JD[VZwKWBh4/ Qj,; swpXtӯ$OK5ld t(5Gf0>x/ї3"/`=OKg֍,aqHezp8?H"2=7( hݎlz1K2N&tC!ƛfL dI!N̞© Pi%$%$ҁ,]KɚdBI]HJ9LU}c "I/գ[չkjֹH:B:2`0'/u Φy{ݏKHy$y;˛G}hP'tQR$xf cfy E $cx$ !EyAeN22VA$(608C3*X`^R&0?@, )$$ !B>ŊoVm%TI$O}Đ.HprzpcflֶU֥jKmn*jYR8H}P $^ow,ڒ)ٲE@6 I$X>@ 4sD@V2I!)j@[y  ) 0_ Mp0 d B!$)g>zQζy[jINA!!$6 @$)~_'ky+ ,l*9b¤.c Y%=uHHE ftZ~4/t{9.<#|Ƿ\Oq/RIQX/kS"6Ť[5\H${+MVsjaiC 'Ө$IŃ5JhV( }!@!ܝcmQ$e4H@ d.I }vU_ $Jߩ d_ .̴1JBYk VH$A"Yth׳8׳a\&C\2jI [{trtBHy -REDGRn>c\MQY.H# L@=txo|:ڴyVUy @)(yxD SeI J3`WNTgQVJ˲!$ jud$ UDa$!:5ۇ/ޥ z$ K !D2' Pb1X.kfܪ )07I&R k e]7hs=z؆C¨* {gªGe6S+E,Ub(1`?+~jy֣|Nn+=~dy C̪GR.M+Յq+,]'`-@RH$0 0ux8v뼶ɒ5Ɉ*+ Bݏ9a76YI$`C5:d,< Zv.HC(,DILr`SEI t0QMd$CǪ߽ܒ4wT$ IoKOf,DXYj'JTcdl )Ks(BA'PQѫ~yGbДw,u,;R 4аoBv ]Um[/g$(K pNKT`):uz:iB ?{M?)ۻ{jޢOFqVZ~ 3r%㕠 u"=-DE(i3`Yz`, };똶N-v~MȋЩfΪ b1PIM>NlM֎橱c `q&8x+?*ښβ,v% kF1xpQ'vw?">ӥ:"|Ip&`(v,ɣ :L!_>ig9BY$N$6wU7?2%*e% dOB?PC\,TND:r@'Slq3"vۜ w2MUdA)T ߟn[zg9<}Mtf|"Ebyni`֦DkI54RhĘB\rlxt>ou:z['l5ig}&E[}HcA!'=9 =.RH k, "(hmbQQEFkc$mF,d1F!fQNV;zvoUU3LmbݯfQUXU2~̵Ulཷ [I œiHHfIhhsV4htT BC-@k*, B}5si&TeE#jlCM0n\TEe M5 OI!=P$8P Yb*IH颚iT֡B6,7֗lӧ:`v =NEk.v,_]o"Nd2>1iK ^m?kZ[mvv ]8%Z6ha%j3d8j;b\Ik@0_Ld uY5]D*m;Bl"XOugZVse>s%D02*=ak<c ӁBy$ o,wPYdQىıZɿr ߞ?4xy'e*?|IIZ40l$F"7& ymӷР<{C; R nK,iSn|xjW2 S kX"0 a Gw|Gxb@րr(k12r=`|H;̶= mAC}v! 9QU{BfZ$[59֜ԙ,DVˆI]>KUf[(Vd| )Ќ njlSP,;|)2.N "@jMHIHr7a2k;Xru Y"ت6!-&#VJ)jL Xfd$&ĐbDUo:kBdb-R|M|6s*qs\S{x_EЯZҶ۞W0Mc|j%DjK:^u[ srɀXH VW ec0ӉidZVUZR"\aK,¯Cw0GsojzL$fѣjkK*\J5.~xb" -(4ہtM, vR&`i(<\*pIsp2UAלy8=݂I+ #4*݈<5}J0S(GqVc-s/Y*؎%cew)(&¥54+rt4f'HrHPkDD uJW߱o^]|svk FۉC^ow6pEe~_6'2)xڗ@M=@[#sT3ʹD1%"$ԗ\`Ԩ412 ɕHr<)`yjf͕dq+f|,kS11|(.EfreygXY=s-7} &Ov6y(R`\ t5 t -ND }dgԱRk5`4|-{[[,$Xj7RwL,Arrن{]8THd!&IqZn3&x n!p(gzŠ)q2J6ic3MIA4iȌi2XiZH"f,LSFC25EDZ-F0 %FIEI lFH[2!5 ,hDX,Z BŢ4mM5ɓ&"(ѢEIQ*f#Q,h1b"(h@Y,2!TUbQF($RhF 3 dEv,ڿ'BoEg=_ Jʩ.dG4ARb{'sM:Jd'ɼٍ`^ $2L}N?e{[ہA~miJ GTpQkǺ $1' gPtNvv8^?~8FQYB^lIL)w؁fO^F*A JR[j@цNm%M2l$Em"HDFL2mbTlHII(66 (E# 1E?S厞uq8?c `'f}),O 0eSf)uj`Ԓr/R"#n||Os٥ݣ5l]FƴӺșׁgYyWhr|]w^ynw;*tz׻Nݞ] ]&;ºt}_/^k݊q>w.9J:o}|{wxێܿO)H$xҘ@_{s^c[̻Som5yWnf/<<ût#6.<wj,[Jˡki#j^J;vLmGwK^5{Z,罩C Z΁\h,ZTc2KQNrQtI*Ho$։#%""(XIBq6[+9!T$w\~^F>E3Ҵu H1z hq/Õ +fͳ'0DD~q֩Lai;|WP"11y[L A8&³tQ6/D b)&h&ǮiAi N=H9vnK~sl演+|kD=um;Fmٽݛs;nGzWfq]u>ywܫY"L7@/vzf{-.)VZei$T>bܦTdAB h%(0[TW!f yTZ P( )MLh0H$ ж.︰\3UBNBmo{o2ϛ^Yv [# 5us|7nzmsz]'{['{]y|[W/~usN}^\6(fdg(ᩜny{e!N&Ny(ކ#գ4[3e$Б|PpJbbX9ܠι˙ph&δ Up3z JQDy:_){罢5*prӅrmdfIa UKUKҸ$SC { WuVd`̜{sk|QAA>>ZW"$b݇7luPp:O|eת3imPJG#Hؙ XY4T H(+Ì!y1MhcSu1c4L ‚<2c ^Ug^Vu@% RDîȺk$[q{wgr#ۧw9f3r^vxEAL $ZM7bLh/Dl1YBs[tyN[,0zu-D m_W?m.nXwv14[y_r$i~bE ,ϽBO3ã<<ZGzTD$ NH4 d&mE,- HFQ@4$IDB"L;TY£Auxxݷx0鞥ƕzF Dc k"7Bz)$! ! vROvp]$%۶O'p¦3pM!N֍V&(0n4#3Ӣж-9Vwud قCkL &Id' wzun/kN $fBn `0KI$I8)$@j!!iFҍ֬TZocRtն[ʈF%K-ʘ`xU-E+#Ł FI X@tXHo I I! bI$1d!yH@րjyn[6V8@6jѝ˧lRRLhΨ9~*ͯTَkQ7uJFm{[BebU3FFE+g&L%jDD:h5@@@%ɽPHB@ !  bު*L7꓅BQHBZC]FxV1e$1Mb[_ OU zHZh$579ufme@Ͼq(Y)Fɢ\,vvA-2(FPQQ3wc\. b,EFR"&S2*(Ye6f22 iRI`I`4bX2fB&DdjDڈD\I&E%c"HYS$D-$!#$156fRk7[LiC s"L304sW-d dbuAʚ6iBJ4%d"JS*!D͈%2 )@ad`1a(~ I1IIc!gλ2- 4DiY!srJ,h5͊1PsLq%4FэD(a""ӨzɆ6L(d"F$HpH$C6F2!Ii2s]42bjKZD٫,Ҥc56YIj0ژ4PɰLM1a(XԈIةř0QM5LɃ!QAȳ 2IRLh2RhL5 b`]c6)4b@YA!0ff1I1h, n2]{ 43SHThe&h{;_&I=kll%F%&,Q DK,bȑ  F3C tgٺ_ -Tʶ Md%,CcR5(ʟ:OED@l#\$* $E.@h2KH&,o>OEwϞ)BF$&"YA,TX5dԪ-6s""ZBHyWwujau(YB^K6ֳ9|/X_WXM#Uk*V(:2)ٳ,.aXB #U^7j4h`lQG,0O7 ",ܤTacE6: 3@ii(-ht0&I"CTMSa(SJT)$dR&)*͓X!(͒%MPE0MDD@8F@ya%h[R}ͯskZ,?|)) B-D gbBҨ|1$C!wn%b)3`hr՟{R骒n&XIhN L '=ovI3IBCFZmBԵ"Lm:f<"nzsSJHjdR)8IH$B"ZTCL2 dYFLI-Ic"ebbMLQ!ԐCQ4XF ()HUFDI d)B"L#&*ũU(ЦK Qkl8V I!$ L\Ȋp&2h LR&DkVl21JJ&)@ A(Fɋ #L ( ILUm(E2JTd0T6IDM$Lhٙ&6d#b,}uvkTȒdYhLK)bH 2@1 3Q2L (Y)))Oq&IH 6BLR2XĽJDHdhfjg}⢊c3&DdR1 TF*,SdU#! Zĉ1 0a &b6eQ REK(I4$ 6hɑ96XbXhFM2IBHFFRmM 2 I2F "c E]*haF xzTdE,!ZɕiuE4THAAdӒ J@4;M$&*eTT9 2LA,,2)`6 I5,dB"YX!jd D]/|& 5٣aLɒבb,AHL9em Exӻy^:˻F;;+=Q %82M$&kW!$`@#mIR`Z,-jR0ĹݒPY!9&YNF=3[0IhI43S N`zRs IfM, +JF@UJd0`4R);=z{zPK + pJkHoFKaB\ !;IDU 1*!QMLAi@ C蘣hTg= ܁Ke koDIڅ7HcMeT~c ʴ !`&FQF)4+MUB,oK!f-T(ʥa@t TJH*fq(a1}Ef3Om$aHR6H$bJ1 4L%DBM 3 1,,PI2RQJ,AIvK2%-s2~Ii~.kN.6; ]O ѭ&1 ,iIB ),) 2Li-Rb D"E%6c$h $6$wYݽWjIDv/{17$~7+4+~    eY "A!6jY ciS )a5$jԧ$C P6I; I$ ҍIl8*B7LX߶h.軏/[POU< e:簻~cxj0*Y Qx &NuF d]k$X:VAj65kmo-BBeiCbJSU Fk?E۽-fx.Q2 I@*@fEm͵l[vIf)|sIQTmcEe6$!t .%:RNw_,.fĒQ*LQf)("$4$ ɀE.D(HfEJR$ԡ))AYjR(ě*b TAEI&S E4Ed QE9sÓqJh(aAA *I6A$RQ0KAV,$S930@wYU,2d "I0ʒyY$(iLQ DMIbB)?˪cFS ;@eKz$K[ I!$8*HN: $`0N'j42h@C.: N$.JCkK&:3q@:RBiJAo RjjqK09u)7iav2,4ZZhΡZ*dŦR ՞v3qSLS^ƚLkhtĆ n3uPH**M#hQCj*Kr f$e ),`.GN! @%*HH`;uztY_;|7;2a$PJ*htL!O=9r_cX騏]FB80$9+TqopRpac+@,1Cq& r `JMHb(#3'+^ ]Ye`3+*#5rMI, I:n^hp``%\VR͔}u.a04&I2qL1YFT` 3 "#avuA;lх)$œpܪR`,m pT jHIR <+˅{0pbZ׀x( # 1#&h)(m6@BYE]ѼT4C%en<,jT,%ۡgr$q$@C{11F*Kgj 'arq`M[7-mvI&zSeRl@`Jrbcv,s8&HHູml)[meIod\oTZrZUe.mЖ( ; y' *l )KӅ;9^Y^ruN2&} 5[<1Ȝ5ĻGP dF&EE2B@RHjMҰ|-1Ǜj1@/i@i_B8^֩>wsUrc0,rm0%.I|$0`ĦMRnQ"„DU qc hgl Md%m6dӲųԃhV4@HYgΚdMRwC at($Q JR["Q%Iҙ hCvwl) )rss(MyWI>fѠa57#1LVQ :"7@F6Q6uݧ\MbTEU:Hn0c:]hY R`Bo$-VlwXqN hLPh!0,1C-4JCk 7PfNӫE,1kM7{X)d2b+!&䙔LMbM1L"p$vη.MDsQcFZJY+L!4b!9|ߚ `M E+zz4pCi ň@R度@%ZQ& "h0M3DT[j T"B2ZF!*5&Zd"D)E2ڨ*R 9ba L`hdE(I *LhUHSRd7S6))TX l-f& A9 6nbMhNRTjL h-AhВÄAPTԻYHer6p(X؀ԊD "V)|Lh*FP*UZ\ٽᵟE` LfXlHf )a* 'd|kc~q*4j`D6oCnڙmoCF LA%*\)% S! r&fHBI2!9$SCAR!2IVK< +7+RZeh5$;wQ HsMLRJ[ hsZXi`jH]f֦d\n&q"6˓R+fB$ٽΰ`ʏIˈø2aZUeH\H7,|rtW|WϷy3ϲ$YoRRٔ-M7 d#!djk\ i}纒bb=~ ׅ&S;vjY ֠D3$QJ$؂A0J\Imy)?@z$ n]`'[,ht:Ethp ea&3Z!nn˴͂uu m P7W.+p6ŖC5JVO]K2lئ-[@wJNc 'ALkW+ElP]FgBҙ֓Q5p6mqVX)82ӗW@.1ҷr&Y1&Cb ۚeBHFmvSDȜf^\q sGwׄe=jc<d%DelsVW("٩d3VhXRHH-VJՎ pcKM0L1\ȅE"4EWg &PcQf_ OyEPK%SphPrsT)D#-$@`e' KU4A  ( PIɑrwo?M3FK$>!l[bE'Yς$g)8`L_%fyL!6ҍSvQ ""mx$&H5bfV2r@{U 57X)>lwW9C&kE84xm:ҬYAwe`sxxZ$WŝaNe30cZa9͐cuƅXh 06Dݷ""H,ب fb*MLk@ϓۥWE  ֛ܰ9Vb(w[OUZk,!S$`q= ʣr'e2Yn<LG>Ēm,nvl0D*-MIn;kWNTCc}vS͜:\Ն Zj5i(mFDdR "QJQ6NO%CIYao[˕7G|A ) `hdD ,M& 2@o ~}o21)()6C#-"A$GSRS&-  cjD@IYF$& AeD,&E!8UJebC4$jO׷d ѕ,d L nboʮT;~{{O^!4э`޲{^*^THb1L$A2R(IAHJ7P32% M͛FbB#,9V)T\VPԶu&cv@MEI !3%)%fFifAJ Q)(adjQIbR44-" ̓RT) L6#F@,r+qH ]+LŘihl 0M 1D`QAFRDMB2DHM|ZAmL HKz. 8N00ɴ)lF)A2!D"KĊ 6H)*`ުQbէyRCR)1&fvS,-#z5&84I`C2EIiU%4z/yC-zBQSPU%A4[L,Q}}_rTR_%lYJqe Ule)/)W-pBn̳1oAeR]i cyXѰ(‹2եf7*Kb0'H(gR$J,,IKhM`.4I*ͺ!add#eҪi *UJe$I)0VTHV!+0RB@,*V@E)32 P6hR ʒ X&JHPb ) \QdHeEg6QS6@$)m"d+Q$*d 1gn!IUv%"BX#*΋A0c6i6BLTjJDXM$6b,, 4X&A I ZM0LVDyj3&Id* MLTɖR6rX'L ɠ*TJAjHJ^so1r2y-(БP--[\@JpaC=]wJŒCK&RLdebgk&J@2 # D 2`ʔ&b#"='|HjC!4d  ZH(YvAC!UkYn o^)V!wMi'Usw5^juY!: FHq S kS0¤%&,B)#S(T 0BËI/^y)(¢@'oYa{$ڼӱ sc X'NPP?#c>1KծUKUeA(ew?M_=AU}6Ifa (X`YU%4 奘-ۡ~BԪ*2^Xczk [=I2t0,hBR I8M^ϽēչD? @2PĠ!$8P&hSɀƉ`U/pztQb"Oi@-7M{0K0#(؜fjMQ!,U>꺪׶W6=yydGPa?ńPe$  2ܢAwI05s_Ӆצ̅QŅa(G~ -X>ZQ%+I7$y'f9 ]x =q!X 5^2/'L5!o cmr9v!<)S 7|@uxo_?\xp9ރ;?|9%/?j,emC6/+o/x ̯nY-uz'%b!g1Jd/or[sMݽ~6 6K@B+6~:ntt 1i6@y Ys}ɺK hԯ|>!hn{ pho`K>ޅ: @ORhe RA$H޺aY!ߓ+1ZaW>tvE )6"%A DA)E%9;uzZU5+.}gPS8HiI%.2;) JŊv[#7OLh|sit=~]l2gV:Sbu kSVχ=//6m n5oӀcwk'JppsD]A bBB w.t@;i n3۝.Ѐ"=P2=~p@MyKrWkg@9 JqJ^D/7xKpcbTޱex3l$ 4Ra磻鎏++XU,> u? {/!:)}#vLODL!hĐIbdj4b_>+[}3hыDX*M j(Jch̠ѵFZR4b#d'i BLmhbwП-(($?)?D #~}dXFf,Er@ЄhI&lC*fƤBqpmv9VlW71b+Eb#~td n-/b,z}ɞvF='D"ɎqQb}*eY Vȏ^4,l6bw > $>3ˀ&po;Rg{.v仲{^(`./ ї]%0.ηOjIX H)""f!EER2"呣e "DB,i^H6}Mij)jiϦiffPHA9(v@> aclߐ0'ͩZ|&y@Sjl8Dʦ, ";ܧʶ无-;YgmzD>ujQs23V\6)YoFŵʐwCsK)>mܤDX/͑lpJ.ĀPc?|$p<4EM-C.dXʪ$r#?ŮEE~^gnQ hދ2t LQ[<\3ʥپ^6;l4GA!;f =6{,b!բ&_w2u<'j(0T@W>ϩF 4S@1DX)WOxv| >ڑݣۆRdQ1Xӻs'Fa) }jQ-l)I:ܽ%MS:)Ƥ \ u&;"`[.L(FLsDNYAnyyP1{KL`s4G;H^aUbTQAPFX6Y>з{MxgHwLCi906[=u-& Ȍ@m˰{yۺ}9]p tC0La`,Y3;:'D:ȌЇFc1- #Hae8Jk/gFS곜<8o PAY̋JDJ'|7P lp 8 gT,^ZYqKH!en/A=4bC /w*XIh&]RK,y.5*H 0((fDNzBħ4`E8;{.NƃQnpN)fJP9 gJ*E 4U4 ulc4 jÃx/#š~fZT;W4Xqak’{>Nnv߁`.6k׺K9bt{@љ'x.4]E#fբȥNkb]YlҺ8N5ʼnT'F|.~(BO&ul ZHn* Ҏq#kCT'džVF\$<(/"Sy澦!tk}7 D/EHٗC'z O{ .nȦ=ftz^.s+GkS$)t&"DFʮ!Qmj/xbsXުSk{mSmDZ*'Gu1g=;@@NX >mUlSC&5w gڷ`qJC@ u( `""#z^1_-ZemH\$gQ?qָS77 }ѯB[BПAhs:f"#~L(HJVu?z4zD̼Y夙ll PuzvWc"LZS! b# R $HXB|~d8Ȅ`@)@!4D$N )!7OP>$'X&0rH{d ^D!ZڱjՍm޿jFC0Hy BnaB$B/ECBXB$@s VBN~x@`c3ΫC#k5emb`nЌH s=!&I! |BRBOUH2}$N$; NߵK\ @##P8y8WP7r %~Fv@IS@[>@{-sЭ:/y%0 j˂ĚR9#{(PS !gV@ 4}Ljl0rΨ;!$?+`@u$oWe[vY~n.&Cmlex"q! !9d(a ~ACOk t@`Z@#x6 '"y@4ñxn/B?:&*E,&bD3|WRhj9I2<\%UT_6xy+! 5 )dMѹ;ő?b! 7cPJ|I11hz8mbbdipf5ESkx7{gE=WUոoƎ,t D'Z\h,~4YC10i du:ktƪXAm+fe1qĕ d.uڈYoc+ qa8sC]C2ebXjCdJ_oXN4溇BM̡=kžd`FQTH ޝ,L;}:qɧSgjp±צ8)bc|,y.)❈TA_ rZ};9]3Y],#-0!řjaRWUQ`&߼c?RC41G7͟b>Z@'~BoueS$qtj|h7{B<}a[q"[}0v2e#IҺ#ֹp[fcE+nXgEPʡhϵXƋ&t`T ʱ]OuXE*%%А"ʴ#*ױGK C Fˈ%,[S&]xѓjsQ]4Ru{>"z}+ֵ<=F:}nwQUHd >6wQŲ)^vs[ 4Pr~+vΣb:A s` Dl3c/qu3.+hes$]M5uBL(DJIM 0ͻ^ 06qjBӠ.dtaC/y `B5XSh!h DObxK-5xQ}ް g?n#In"{*933 @L?G>yiK,[-Lgt[+?8>i! }]oMl8Nx2[ʸY)gI&%A rT͏`:Z9eҤk*]k+/cEj˸*A,ߤ$a>c,!3HB}'q&,H{4 @)!*hcc>!2'I'ٽh]ϣnC|u/;^d$d;(Bp'v "}BHdÅuzCPH3j;2ҝ~w2_?EѽTDEQC25wvԖ>w(O?*QW.s}/C9xsa0|HCi({vd퓔n 9`|BvvH. R_A> r~sP#Tna@%6Jtt# Bg6@O` (m‚iN;SpŌ$Upe^aAF&WrO |=oD`D3,2Jnr5i8AemP/'E}I!5s>pzV0~Ӯbnr0ԣJ{Ե@MրN'c0ea56bdS+ # 99xUB!Wst"slwSka%oej:`u;6QVt71 yo L)vWsI%2'I$tXF_诛-c¬wmDjoS5F Fu*Q F\iz5̬(M<0{/`<w]l#gD[QXCO*Z2@r В~zk 3"/ N [v$;ěߓqBa5-N~3i/1<]vlp¾GՇǎ)?A";o,iy=o}`~U!-A''?I|г9ԕէ|vĕzWbNdyz׏C,&\5A*yyܺ"&c!7z*U/qPlqSÃWOBҜ $G;x@=m)s\ڸOLj֚>Ł5Bg>ݣpS&@g+&٣>3\=&NI-!Im:pd~]`m;_TF'MzN>mU嶷+kcnn[m_j1@04\sƙ@c$\JBox~BI2|@ ^KbJ@XM8}HvU 4 HnZPS?,s$$)Woѥf_cKk[Z&`ȋbt(,9iym'`]X"UZ$BANmhO.on6.y:ra b{Ƃܱhg+wQCepYayDn[$7 s/5=?)/%S[ Jߍ<+Q>5T0z]M)GFD Ӧ'pYZoCHxCOV§oK6Ř"YR (D DcFl>T|ҟY|M^Aq=_KuI8YG߂ b3/O_ђ ]B?v HŊFR?m^m B+FM-뭅Nf=$b_yא&yJ9QFnݔ=%fZ}jS &>" T@Lhm(`=ez2L(֞)v`iY U'Ƶk[[7M ,A8O-&2.cml>M՘IcnPnRAt| xm[:em^Qۙkth/ Db#v8,N#*ez ?CVOgֻy~ wc 䞏~hWY Nu,%X?:^/7Y}(UseZ 5[PLRTX-2cKc&l XspnShUn&,'XEjE!fa[13EKWhfѕD(VJ5rÓ jriBRF{ͷ(5^NmcT`YΐNsImPv~FBLM)뭊Tg?#7/# $EoK'(36c.7NP(fC߿ݙ,žc%)+_Ck^r P6S͞N*a-;3¼lMR`GG`O[1?;s;P>`ܯյB~]um4*YE|#t}`jy3݀;u-ɳ-:A֍#):nl쮭X VdNDL.j.X;:Jєf,lИ&ʈ4qY9?y۩l;eon 2,VGhceH•r616#u#;"2VmWLCtEx]{޺xu/*:&$dv# z~2Q\A[)sY6ˣHh2 ;s n;mg:4H6A9-Ԍe:o3Yoq##~E h̴^lRs.]0(t}5i{%ěY ȓ^T̸˱ 蕔GH=SIaL몭%z_a|.EӃcLID%%>B||(iFE.gWL59 o,#6Az9͕|Tѥxy(<\6TlG2m[6:P.ZF i8QcTYV v&!Iu[9gu дa*q7i Xݙo=I`a|Wմ՞->pGi-ܩN&mX7jr_g.)?F&K-\_N%O;th0F3w#̕/\sZ`~sq xKN٢0471ToTG_WAsSMCoB_])WK~Y#sIKXvpO Ȕ2Տ]V;uΗt~O=9| 7қNq+5K; 3epyXt(C*%8]Cɳ/ЯؔJ&Ϧ1o%}L񴸩|__פݬeE_CIq".هu#<}ck٥dT=ßR9{ in&yf4ygJƊ0s9 9|0oyܟ=KPĞc=?uVsg+.5DwxvX|ڗ",Ϗ}S($֩qt4 _i9JV8ښY)fK~ nlfn |&⧽~RO&{Σ? ICJ4 l&9!.V>TḖ}<|'o?TVbxMp0]LZKj[ u%bf2c!* H0"8Ѯ'85jw6$dccy7M#{^EޱmfYHG9b3o?R:vsEaҦT)"֑$[70}(Yumqf*9 Y"[@pZ՚׉ P^:2BD"dvuqĎ, ʤSI.sԃWeɶ-m[k AA&*:G8jjv36 5);2`f{"&IxP:Ӑ8* Ьi>, A%!rQQl9{hqejL5z;'oˇ9~TK Ϡ{mz$P{s~cyg lGn DMF(ڹDbU@nYGMY!v t9% -rwlOa}^^~F-.ʱO-0ag#t5qut0TjSDQ=FK4rU?t;3rݎ\fPdc0`zWH?pbX7oKB3Gqp\_zW|Va(6D"5 7#> w]!ejl|r3b!龉7F@ď6/ Jn\]QN!t0cCv-[9&#5 8ECiO }BAȬv̚_'ePT8B0(,Ӽqk a go˶h<6WP8p>-N>wwДK!1Ͷk\l!T 5 1Ofz\.q(Q78ZT+&¶!oBC Krs~L 2-Gjm cK~1fd6'0Db4p+@qԔ0swFZjӅK%+5! #be3գEkHǙDr_px]Ce{ue\M25Z w-Ҵ'`}@/xXc"nY5]iT~dC2Zd_-0!qU?T~F-Aaz*=:Qg9X^?o?mlO.͆Akh^e38lw=h2A*3+ Ht#)^G\UjI¾BP zfQs<,=U˟ĠS o=xކO.g^]QǓOn@Z_hluҸ]Mq ۣB~)91jH9Cr4/9 4te DDDm5I ,#kV0q8wj[ObcYt4:FsuYII4,{ C& G/e4 vdٷrj-&p8,`*^nT;q .huq%H*<3" Rȅ5r H۷8[-o@f2%(F`ĞUषIPtnۍ)ӯ+)B~S :d38fVI'(k!O?Z[a)=fҞ%-џ|#~էY4o1?;?Ԙ=?cٹ 9ّÃZ]og뺻hqQ* PH URTJXCӘ~5@'d!;@ؠ@% a!'7P=B{I$8W=dH֜L M!ޟC;$F1B}C,*H _0{|[#,a$9/5!t@O)3aKܣ2il],rzs8*>="N)[B(]ŁE<,#5HA,|t jt:{ Bcx& bӢ"neu@b J9'C=O H4pU Oү NLg1* u$6B9_dh7q|44r ^jXv.`sDo"4٠ cؠ 3;q^w 4u%v5e-Ц~'>/xuɭy'y!t&Ss,mxn$P6HD;ubu8dH[q+23i|d/έm%Phi f$)$S Ge$-EStm\U\TJ߉R/|Bhu@̱)K1FLovtQ k@}jIx{ $$T $!C?z C$ĒHgU?:RlX'|lhQ` S~2T 93|L?uq}"1rEj֏=|<*|]Hk 2ճ'۫ͻ|*doBwh"L$v0yNx8#HAj]7O`z[V^P-8WTN65A?%'B1=p9hmvGXO8gFY)V$gOFw 0: J*'%vs$տi@5I/0^ _+|av3jz6Oqtw ~$ـ? /" )&F< Bߏzʢ\"zwVAĬ/خѠʇO~?z̯j&9Xi*gf"+s=B̐8J:6YBB1U `ĝl{H*v$T4)턖'TMzy8l5y[hS\zS>BFW[c*o> ? Vy\C]Eľ"їX<)5Ç.P\{ɜgfLL>c {B#sllm`JnkXYTyOkв=pd2\So 6PbeVfѲZhjc@>E_B" 8wgI*M Q'ch]3oH6'zʲf/e;M]e})sozHPM $CS XO6=7ȐopPIHJY!.gCWe7puZ4kbLC_Tvr,VL,mD';+Fܼ\,2DCdk0}UhJZ`}'OʴœrфW$zAB9q $9/GCy6z?A̩ڃI9XfO1 fhkCY<׃迅>r $qf#9Bu'-=tY*MBlJ;_i›#ULfw]hHG9CBn6l@Of{cΡErXCԨL) oQHC'cgCHǢchZȜGHfw_Z 6?9$GNɣ/X(r4EQ3Q=NAis2ۿAԦ5@JD^*%Tٟ a?Q%ΊF&'sW%T$bAu4Z)*0nIebєJt[EkIt1L/kKʌJ!W( -c܅:6XV!NUfm*0n4hQ@ PdXQb%St}c5T " " $$0.A#!{7*볧&O  ̫MQ몑=>"A ;0ȳ'\b={MOZ|m· ,-'$~ڭ(5?-'2CaǬw㎯2,EH$N,|@@8c-}cXk+/b4' qPK0 Zk;Mfj.`ҏR&~ѱ]SdaH⼰# | _-2 $WKS/HjW' ɓR/\ԣ~DnVZa޾a$WV"(J2IfBń d$jl ! @}Mcx[ј@օ`gwZt.S4Z䨳D4&`hfspn mu cdvPG}]Dr%--N;BrHG~ "+^'[7BgIAUS  b"bm^a/hO _`O IdjRIH5?$}I$y߶ڄ60@D moޟegd{=4oI@]lAEnF-ك/6[~ԩ:9-_}Mp(!t+5%( N0%  vlb340;aCQ%D ]M X|P{#=5̔IE;4n:NaH~3SBʣIL =!$OQK}tX T0\v[^fpGP}w#vꭵFbf~,yRϩt_aQE){콱2/ptcc #+=hiCXf#C3zDX=`Zd+tOk+'h W )[O?I}!b.t /RG8d7uO&8pu(3/RE RĕG-/B|5{'ZهBEд$ E0s𾻏?{y7-Z?l5N??O5h>b˒?0P6uL' p4Ǡ^pϺNV(m1P Mj#N"󗬒t2lLlB'nr>/^8#oĒ)$)>^&}Z M(B}^pׅrI.åXI?$'XI$'z 7se@`Crۯ w@mŐa/Bt*jXF{aG>9?m{X!cAw21LcdӢYP)7aPjQr8B|J7K[?}dFIY &/vńXwHHkJ?T}w_79ZYqv4€]K9g]F|2|j74V?0A,킆A%0e:㨠'E|f֯MӻvI}5Jvyh}Ld!'3/go|uN`1$Y JlcԡA䁺$$[EU{ȭ?ޝp!#6toK:JQBHK`# `! 9W- I0t-ᔒ$BHX/ rBQTJ@(#I^ b=ZwǷ#ת_!NOQ8;!V!ƳQ ӂ0J,_~j>~wKtAHl]. $>_a>OYCI[6oW7-$< C`O2@hxA<;wy,Z;%~NHبӧϰ~b~#S|ZBkg^g Y14xp };e"I(߻Ż'.Oˣ$<~L>C{-W!I$P0ЀCCoO=.>HoEޫ|  򬊬 8 "mKge>+iHLjz۱:c )Oy-ޥj әnɍᛮ.iiI%6= <г,M[ Hw\ޤ{5câ>w5A'vhq㮒Bf2,7=2fj޷CңQ3Gpp͖Yo#.m d d]'0W6>WAǙ?syqIwku]??Ć)'^v4t̰N@Y)xow CߑA!a13hwkH~ a3>s@ݪ$RB[os&}8:i~ک;lm{ê=KsۢZ;- zr! F;/+}_̿|ԭ·*m25?gl%$ 㶵倂EObK^/R iK*&-unk$ I@:%!zALF\Q w!Z @ k?_6m!cyuԄ# "d|hYnY.,9#3f"Um?eق ?{CGC_@e:1/ ,O>餩DbF& tWtK6, ې uI]A B˟y,VkLdN.e]PJwj5 I&Hv!=s{[fENy4S,f0d EjY?kO/*uפ <{L]5>g@ )εoiUlB~W|| WA&'#I Nm y$O5}?mr5d2ÍO\Of{^ %9ZM0?k^cӑ&8sc&9kv!!!'>Aj0 u$ `X6o;"WVEbďBAzﺮ/T ?jC'1z {W@+YkH.A ) BAd#6mҙ}F믟xsb_[y:'7لɜĠ-=߮,lmng1̰%eNלfUq&|3A1i^s`TuImf9_D~m_u>OFRudjHF0rڥRvRH'PI~R cX~8QBb=zCݶ[t$ϖ}Qڽ{ی/ǯNFq="Ϯk^WyYԂҵG9v\)ʃ,?%lw[ @E`5:tF#?9dq5DWxؤ?q 4ޕy]q@)D`i4&ڐ5nVIm΀& 6HCY`N,v{*JybI"#s-ߜ &BNHHp$!?vY3`CC$5 E=J\yNp}e!]6!å7F@ bO7]Rn܄RNLRBk@3Cg+3FlE*F(XەbYVCR|v}AqeRBණxe{aAKMf~^ccÓF:s|9~[hZR '.>GyR]kpIW>1s= o7b7! %A|DhY46߶ӓ; dԩfqKX7S֐v 교GGF#1u/>#7#*m݂&'\. v>OdOcZVuDpafH5 ~T+BZ ۝IP٣ѽos7ޒOwU!3l@'M Y {4K$)$>F}ՏHp==! PM. ! C,/Uqpxl͍$ z-BLRe֩:(8C}۟YǓ}2kFWN ;xI6 *q)|I;`A V tXu q8U4qc7JҚ/e\&~&2Jaе^ Džiigh]),h8ꢛY ;Gar'4%[jUΆI}HCAZ $p1HJTyeciFF7R8}d2:yt>OGW\?uy7miQj-"UR) %<͘PXgYFp^,"i -bU7K-iE$ 3*dVJea`6AB ӢB"L~S_6hV|?ͪj %MVb}O]SY58e;3Ae;@S;`X"EdbDy]s +οVJa*W<}`6r^h{P~Y߹ɟ㞀A7uDfh(GA[Td7EV3L}T[(4b>Kt3~3IOe7E{W?.Wgi}m8}=8RCBYsX$'doqg1wH)e>}Wʵ •rF=Ɗ-٣OŽ$a RH|ְBNm lX)x$a1M氓 gJO8WzO)ſuALPԮef'=!P?**Wa _F,FdpE=E]<*# ,NbE{o׻} 9dk_ \qb,Dҁ νϊmbR\*Ż:WVaz˶}IYp0$H.J,}.Pڶ[~秛ŔO)5Iɿ~ɏC$VՁJ0Q "pm){! 2!05@HF=D>P4;@$@y};asc[`1(֑/WtG5[t'0MuUd L#_sLAlV;ִZtO"ouVa~OG]~~Nvz< OQ胰euٹ' ( ~ȣ_?eZ>7Dƺכ[qhHpGȅg e:2ίU &BjI B*HjBjCYSшCZO!v"ѝl '(5$iz*vsĵ2֘Z`:%0A?7+ČTu,_Y׃bݯ&$۶S:7PhLj=v*(a dFt| Җę.X24&^غ]vwU8c |GKj2Btզ]j]ݿ sGMv20M8@$!֤7}j!>{/>@9p$2 c kѰKdT+nEQ]]c*ҹoulIַO ](sn!βI@}b}0xߥyb>rBk31GqFU7yo晀!$Ts__$lN87@1meO+lcOGW'$ģRI4I  HDŽcQԠ\$9Xߓ]DwMt';HNݺk{94̹|\8{ejo]Ζݥ}a 5[vҏ<$#U!)HL~eXʋzV0U*o‡UO.n)f">D7ċ) vRlx!P(,8FI0@!6ͧy,(謾TJl{g,&UUKLd#9GKz iX.@P͖;i4KmGsEpfنu!ɄT6~cia-kmU;㱅~Baa+IN 7|9|'ww.`Kj刐 y /l=9t:3hj\J mψ't&l4i5wX˼~kW#6T[{D-]?F#} B"ΉOYeIYm"\ULx&$.h}W}g`Q`ߡ<q6' D~e#b`~o{Z3Hpq4ݏj9o,{u3{dѝ~浩'j3I8u{ | uud8E&d}<(Iس/E|\1~-\G$/O+F}D`W ךȣ!l<AͭB15OY3N/TgBryjV)iwzdn ֫h=諊%י-C"[m:ZRGvTLۄU1P]H$".P$wj}l50`Ë9p@m#kɖJ%Y}=Pŵ{䕚$)"? ,#Zrg3p(;Wy'HL0pEp`= Yshc`V;~\b2!VlJ>J2_uZب++x| ugfZ#*ؒ9w\lxzVs7.,{3Q^'"ǒ`^'\)!Xn pRGcROc/Re 5^!qIjj9,H8@πRTUO3gC|M~r3DMNw2ؿH>'ģڎ 2\Ġ4jP5j<_Ւ>S"7ѳSs+8zA)iat *bt<!N%-$A,dh* ;4n4LާP߽(,'_Nݘw]F@J@~L$$R$ę&g]V0=3`RkImN^mIˈӃ6 \W2^!\Ŗ< :xSzLUPD)*,nf=81bI+g18=t1蟴+$(DpƼ/J"| ȶc'DEBnt U'VϵW=fFSvqLrL-bj2⌛ȼQ(QTC{ }ѤPo_ڊod-FPO*k'xSup;0]s2+LTg"Jr#|4ْمk槢9@o6z?R&Fu׿VXpOrdD5a;"}|&ͳn5"~+@FImLʺF4:ķbDTFTťI$ ]/"&+Q!@ѪCn"\.mlba| J/ j|DqDHH~<^.|!6Sy[)cZI._r6.~9!Z[$tG"L솝ws܋qe A;$k>?TRfEҮvˬHuF8碼=FO)~J߫@V^gsn⥓&,>oVHcvKz"#7,Ηr\KLgy\u gGs2;NUW|Y N# ̫O{]>(ɹB;;K!<172K<YxH?_W{]sDEy] K:`ɩ/ (;RD lN?*UK*ҧgS@xjƲr6ĮM5)SFĢ.%jM3W|=q[T1mCtRٍ7I!dP*N`" UIQ:ۮnA1;yx&Ulv)yi36LŶx(ָ֯V?Ź$A"ʳ i/-=rI 9+%Ri'q;ߞ?\z?@Y2I?' K@/_e{:ּߣOSحA$G_17.uA_ Z4*`%A7W0g]vI) O2OMk{YfG}]kixqT@R3BQrY5seŷɨnD?_!Jd ADl^I>}Ͼ9 >ky @Xj C l`b=WK?=pދHNDXjZ.6ڑRᆎȰKACtW?'bf'՟#);r _1$` 7v0@+Y0tT#ϰ0 /q;zRE?؄^hm{@BUY Ɨ{[p-Wy\]~:% :Ԁ@. jI!aW|>_ނ6_g{~;A<z9c 0#ȣ&-Բy{{"]F#7a)D 'h njm_i,m4JItaZBmht\ | XKpPI.f"C)*!@rf\eKe$" Y%6Ct,ՍT'+7娏Ű@U @ $X ,P,-jՁί!z AQQ)2=orB~"ѯqێ;G=If#n^oaq9̪̈\qOx??_կ&Ügx-gcӊIӕa`s`kO^ W\2|bTV6s1pæ}5.D@Ph^RcU(`oTR- kQp=fUp.<))T'!;^%ᦩIj_ι}O"Oӹ`/Ӭez#Oe5#~ݓ#~6p̐1LQ|e+XӔ':3hŢ.?t};v,2G0Mu0{Wc U$ qUJ0!D74ZzXC~eISPjWa3'%e ܁x8LZc:Fke{;n^ Zn;NJ0ˡ:ӠX9)2m;5q{k"_'4fv)9SIo@ڄu aWqdG p2UQQ)ܖm'_.~x[4ծ>[نAmsQL oMS&voN7Ay"M2?RWi^gQdk=o"[وud/%`n61˛.fXH.\%[OJ*M6ht9iįTiX O,gHl!.;ReԔr%~ru ./*88EDNURިrө!=84k=$1ȵ]]¬V6NJhyO1?ټljőI|\ܯ_kœ%R:X = UΩ۽gūb`Ե#?xiήHp78mo{+Q5ӲvKRrȚe7]971>W̓g='n /au|wdل^h3rҮ1p繁]*:RaދEQ Dz&<Ԛ3wCq{7[9UO>^¬"ۂ| B3ϝz_vܒ nKYľK(L.CBʯ?b#P9 ҟteIe\ K1B^Sɼ9of85K#+bwK0%ދjO! Քb~ǷGmM"jtr3+w "ɊEBk^*tO췆1,Y<}%`fO(0}5?mKJ 2 \߉BK,H sYߡUL 4D|?/g l&#Ɋz&-W=BdwNu2][h/L0cx$c 9>j>/V͢Tָk3Q'ϐ8f61FDkM1qcQ + H-Qkk ,%7¸Pr1+} :嶱HBFdIB`8:_CAe4@ |0][nv@a>;,4t*[~}gu;Pl)*=b?|JC{Z]r$DE{?9cȌ -<^ yC4<|'w=~s| n|V?HCG'<8:|pcH lkH00I=qtl=YQ[yLl/K@~ǕsYo{,Ű>Α=tRw;G￟Gsr>W v7;@\>ߺ{mӲ;=ݛ? ?Eύug^7}~>6{,.Gh=^.;oXwwmq|yƟ7K{o羇x\iŎ{lo?w/辰~y#[ 'tc+0V+tm:=_|uݐ1<1gP E[R`b˖*e-ڂFHO(&&uSC 8y/̇_4QW󭡹!un9N`5\ 2H/߻ΤneRe}S18Օ,eos"HeҦL։m\iIX{Խ[2E5ifYkObvy; *ep S h!($pkgAG6m,IEPI]j NrTۅ"׭\ TK}\U$$?w3F[Ud CxJ#T$g9\K"AI)sjQ`p0TSQ"ȮAkNlg[~8^Lo aܫٱFLJ=5/mWmbTꍕQJ`YoujSE V&Jue;rssTHj4dbCg:EOѪoJ}Iyj2Z 60=;Hﭾ2/9vep&iWzT<QD3oɫuQT˟ vtܸ2L54t6 >nF5Hpt+"_'Nzr70j3 Ƶ-> 9՟@,Zr"}ϙJ_al60KPiy0~:,T_uE|r'93ޱ"vmD{s1!D@oǗX4L&4J TH^R  @!f m$dD~9@S,U;Rk>mF*(ꍺ+oU**ڗcoRmQ^bﾭ*5UHAV.vf*xIp}QDy[wTR[=*2󆶾]lu~]~NN^ZV<};һ;mN%fR2Ó@>.~<}@Z s);q*130\NQ7KQ%>Not>:Lv1X'i,OE2$أyPRͬQ|lUZy(4OF8GɁ'9iQx ҪҗqT|3v8}M@w{Q6)5F9]*~(HG@1m/ Z˄ Ȅ7%i})5аºdLv~Т6E:%&qdBt&2^ $4NweVWQ?jk~+XZjG3兓`RDN&~US&=}(9֝}\y* y#Q:!%satm#y!m:X6 sҫdBò :-%Q[ݒᘱ?Y4H(sƢQM$VDeg[׎Ya:hR4UuzW(:R%E+h3i58Ӷd;CǾ7 !DB͊h34 r'u]fMHRko%x5T˂ SF9b~H^*DIe&"xG A1,(":^x7Z-zfeCд N%MY@/E3qGAIS~+Vw@`" \,ދB)2$FL %W9TNyv$[& B$HFcm MD@! goXdKm !'\@U7K$`;H!б|_r{)#޵ CbdžL cb\ҫh$^{QJd!J[OIt]V~-hLR -v-Y->nI pk ;bN\.`l PѦ[g5H/;~1ĝޱWٛKs8B s.G7\N| \iً!py47~ o:J%\պfG }aE~c"ɸE^n',0A*0A !3"n BeJY6J mZŤ<]?GhH椇O#.}s,Kۑ<ˬY۰P ?λ !V]L)!@*0Y)80Cy Ml,==3yGm㓽f״B}ayzFTQF?O AAdBռvID^NwC]rP]  (Pav6Or4_&/ӿe M-ƘY`kXr+_+Y6|\7܇l}4NҔݷKhM8Bb!%!eJaac H*XbDtOV|PC@{\ҴtԠ6T q 7#@G搐-**oߧCoTa:0wg *k릱V1VV#ci0);/HH6g08Td> ӷW['_^S8afRc|\j+oS?_e|.A/LHQP2 E4dM[n-$+‚fdh 2rc_1DXgCfl9lZh\uBEJR `^iY:~?˵!,4/^,Ґr H]:O50 )d)(7Ǒhrf~EG.=[o?E;I=15;m^m|CdgKvOb~v@~|}Ⰱ8P}F>oe+b =x}F7ݩayٹS7E[D`l4iFJdH=[=]?oʫ\{4|n 6Ԕ~/#2Q5رu[kҴ6*4TYH $@QEս-R77c>jrgtig<,;*|.WpITW5a!j,a!@E Z$7hMf$=usK^V1Drѽo k߿}z%VO6F^Dć_a-+}y^ra~PHHzG= ł Ǵ(`^gYDһ :.1#|M7Of i>šN1U8Hga>KC{6HhW}߰ DSK  ƪPHd58\kd**+z9.F9.c D?JUy%2( EW[dYL0ތTT}ѿϋ%mFCF\?1=l%Dz\݇t8ΣWcS ,RȕJ>OȂvPN&+gJH*{2uW&>r禪.:^Y2_trDz瞬:ALK~k~:vO_2Q?ʻivl-Xv:) 8ͣn齤 CC DwFs4|q7"Jc2[0}Ƿ}CuCqRڂX=JVW/7UHJNm 4C;E1Dk^Jm#bF83G:5W^t={_=6?q@bfFo7pS 0H@?U-q}g7;kKn0ϴ΅>I !-s&u> PNd=1cIP'AaD0Sؚ)z`'qwj]3,4.0|[ݤ:!Ig7ғ2H;\!&HjBn/˭L2BYNsa:Q7$cRKV_B|ߕ,:]c}r ͬIߟW}}lF\^ߗga u|-VbqxtA[x+*^_RԬ')9 g!pHj'~ hLt(䶪:ҝ q>F }a ,#%*{JZ Ʊڊە_sLͻfly3L?% χμ<21Tk5`? ^*鶊϶:_W'ɸ;lʘ8Y'ۦQK; g&\tNYh>4OnfaHE]lxRkh :J bbIuK)eB8ijya}p[5U-#)1sB5mK-+v.=Ko>Yp_=Eܘ6L<F8 M;91ܨH LLF$b;^_?:XQ>~ٶ@GD-d\y0S3ᨹw|(X#NiXx9Sůۮ~ .B F "Kq>F6Ǭ[9bbBUA/Oͯ5M={hV.Ҽ_¼7ikvJeE%ߪF@)XzkjږYz;_ˍj:g.N,9;djT#@ꋎcM-{*,5Ri_~全h˽WwmFOdX=)]rkJhK9'V}-X;orƨf,]X:L5,ZVDGiUSKB4Q1ILI$trLG@ĺ,cZ\WĒ}.<&5iB(s&$@ q=Hdb ݫgM;Hifڧex,)I]U e|I'~{}eg,anU^u*̝4H޾Fx YKŪn/itӌ"N^ɶ҂bY]'O"@:@k[9e7tv8mOt++gWxoGwR~~&aܟl~c`{.Hs}Xh!:9993\|@Z,TfL, GO1BS ;zL?.1>yF&*9I(`=ATiR$ШGY_m " TApUz_Ǐ{"f?K\^2G1bBXVٝm< yx!F  ` 0w(VvF^c` މ칟}\svE7,ɻԸ~gZ:o5vF" Or>kĹnT]K˜F7ӝ4[JrHuv^__v:YH/tcA/!Ȑa4",+ƃTXY3Սgq+  n9vEyS!ԤX! Dqk2 d~q1~ǩlt5 F8-vk,x 4!pzoVG偌露8X) Q 9S:m{l|ct kꑁ)\DgQF9^3{ҥJXL#]lP-~FF0 EztEtw.hH$*"Fƀ agJ dW<6NTBx.aۤN|[C^7a;0[] @#\8ccwچfe>.\L< %󦂎ʿ.i^GE<:,Lގc>{8$DxvI"\ nJ݅*ݓ3P]jֳmL j|4UkJ#n f7b!fI:Fy||oV&ٿTaDyn.9`|xNh1/z;<ϡV{ɛ> Ŗ $70R49[7 >biaVOd'ɛz%x f‘ϿCW{-R!M9`{e#a'%Ssfm(1΋5mDZzy*XɡFV^VaMvϜ@:Z DnUX6/I}o^va_[ p0 wH9ry(HھBYg{ m7 y@î# hҥ3'yR]{@~i>LjLp}tIGV=/<08Z1 yJc:q9At>P6Ă+p/$q_v3 MEFϛ.ij׭祶d# %/ E 4EST6XiKe n!a cW#-MJeJ9=wݷw|U2#of?w9H~,0xn/;xy>j!8{6pTbeʪf~Թ _tx5g$:V8RD` $FQ֒EEYLC '#Fϫƍr)x0QeC#q6Ԁu%ߝwD`DbnJ_nyD~Tp;&3{h: qY(_~;#TiQ$B#H:HԧLz[; B($0"H _s?Cf@?f<Xa)!2J+ښœ o[ pdtv  <wv\c"7㹔Opp`=͉>7e,P7eFs>zǑ ]K Wi]i Jg} VLc sKAHBs>U15f|ʝad%M! DA ?@Hρeosj9)XC' ?k^G+\ݮiŢNս|kK@]YiOڃp)@Z@VCa N?v{03f_kM8>+jGP|Tߡ Dz8}r52aK*~_iYm[DOf͠Ʀ2fںljKrI "mW7%¼ *^b)WF bEn'L7NG9] 7;$# :vb|y@0'>I#F(aR:yVmQ_"N+`pSVVaэdZc"h1|tOk㑰@}6:pv#Fh!Ŝ!BJ>}~ 8{AǹlLh"\^vo|9~B`G>9 ވQ( `n' ʯj֨l<%zdci۞/Yt*tTbyLPKmGC4Cf~lᗈ"2,$f 42 \D~K_~,~h ˴ =E]{a1t Z㣯A,I0IgTRA=I{}K-H̪>w6tEl;=70hD.@Q.-*p!7̸g} Hy>6wPNͪK C7C=0=Ch@8TD LG~vƀFzDk NzH @;>2MF1at\ӆq ;n!?k{L闞e-;Wt|xvrR_w;,-bk?$v\-`N`'ɃyyhCY^[q֍Bt:bcvnk1q=eooR>~㏵{qm>qΥyx^3 X׍^(_)bU͠1̕>$?}Pm?eT +IT(upoc)F=u$\a{WjTIHrcA#:wUb B|8iQxgtpo"JZ gc=4E%<;,$=]:$y:,aJcDbͽkKej`^p F(f :^r05V6?~gOR8;yi\ΑPX{Q%q D:i45 f)dnhzM&>v7|_Gq&ta ¡yH(w3i} זSلLvEdx'Wݖg,R{x:/͍=,/^ZŬnc~vഫe D3ŲT!qXaɋ>I\ Wn<\t\sl?׆U[郵ŏO7[wU(mfSQ5W>[z*-@:|ٻgԿuPF̑eg+-//x $؍%EGz2$'*&5qshz<;o >tȼnHnl}p8ūŢX#ab{M!ԑMN0NN8vbEnҷIwkt}Xm b|$""f뗕o Fͱ9|_B_iTVUc~O^]N;.V͸jXI`K#x2Fn!Yڻ/H,b|]F-}:0 lQg(4Y6k,s9-C^d(%R#-+ZK2y"p-B7z~ /쿞+UUjo.-d988ɩOw~opWRF} sbU{_UMt16j&?(SV6$pSxSydLdD.p25a c|g^6he0*b#Wct-n›?VӂLyH!N̩wl.3Vٽym=!W$j#6ȬKzv^U)GأGi|_jhŚ ՀC===<7н&{!n,W3EQ2roKEӇ!FƑxc(drzSn מβ@2T̨~-J_flR}GYlI/9æk2~ER¼Hzɳe{ĊxQ:88T8zG):d"HQg3sNFܓ1' o~rlY=?N3s]-\Mx>f #n|QEɒ{͑w w>"=e.34PxV${4BK'˪[Gەyyu0SJZU*bW/ G¼SL] p:~|oHvWTeW` xA4z(\U|p+Kf5`˥RFJK#ѼeI4ݶ`U03!E{:>}ہo9_.*/`ozYZljPnOǿf(dorXvoa$?#%'7U#DSeZ,$b=G 1gK7×j-]5AGI@lcVUaYN;@ z$`͵I2'3euvXkp(OuKݲΦ{$_WL[Md")R9yB0: *Y p=d2Pm_*TA)O{rT%E hai  Bhڌ>k`*,}y{ȹH1(h2ɡ).LZ.|-TQTpQlR d<Wd_Fm(q"*~zC;_ ) n%B XP@΢:M4%;qHq$=CmT]Z*,iw :iKB"/o;mY/νO [܄ؒl[lh~I^B aFNt-65& .0OxSګ&svd OXAgj}Q=n\}o6}9Ļ](R]"t]FƮ%]U9dξF:iYU0*|l2oMtƠ=:"7ooŃO~Fr? ?cxʍiձ)$$)0|,nc zR;qh9I8eBl-м-T8~oco8;)$DdA GZEw]X=HMdȇ4^ ҿ{+ٷ 6q's]jh 9eG)ݪϧ`StnuK.ҐUE?ۉv$l4~XowR'<AG+m&Jt͏HR.eZb؎o&77*_ T$.D(9R"bŌq)žy Miz]06KHA|E9 XrAjuZhz;8V(Bqg^,qz6M܅0 #|":sOQE,w%d%mb$6y0/uo=) ߫* DwMbV*H츋'zZG۝Imw]+Xxv$C+ E-g'”hRqogmhJT4=yq6&[ !Tܫo' |Zu/ƚ$9PbO^3Kɱx~&B`HiZpC0[dyZWW;|Ӱr&4sT|ś(C˄%Z7/T>4vOo1 û*5=d|WoS㣲x:?xy6秼2]?gv]|e,^Mt:[:e+ƀSqxzg\Q12R9_=; ly+bJ5ҕfo#fG6hg2]"'z7]/(%f)Ԕp4̲nJǞ蟻K3vYl~ HK %q7VYgql ~aԏ/`fIUqEmI s2q'9"YݿA"y=ڦY'F+5:3%x#dGbتVY|b)֯~/Vt =W8h~U:)ViC݋~9pKg_>7SJ!yǩ"$=60/pMק+&`aa&Sض$g~7,{]К }V;7t OOv~kزfç`kXVŴFuٝdxTQ*},Iiɋcj!@%3oyr&M@k#  k(qW^6ôLeَbRڒ_kWIIW1RXެdI?$HVF{*j΃RI%#uJiB6>%%, *xTnʽ2G6A4G9spN  |]7],T C3% aw1 )ٲ)cVdƄ~|+C^@W/<w!?ÿ3+ʑ\b?B XXcrN~F!tK369&y;$;>r72N+Tͬ Wh?kLz}T4ye6~]h7i.b9awY7`4*#\X՞Qxx*=Ovn-6Y4QfyRT7xRyudR[E&[DKhQ>4WLe%sRE QF$ki]$/"ݱmr%cu$1zaW4}lQ2k]fggd/ʳDeTCгc$}f|%+8X@:-~.,ݽ}~+=Z]b䗛TIZ4*mpjsvֵɂagf)#&Oa]NޭdaZ2DhtmL/$sC]P`aN?w4K^ꪙE~wpZ8Ɇx Tz41o`H`*c7xM] A|R:\HWok2 'bHAL*"W$LTթ2cKy2}{'68_wVo="4Oŧ94 GS7>-b.@-18]iz6;j}U!1D dl;bhC=|v跥ީyCfʞɨ&Gc|ҮH}oɞH+d _PclN}g Jy)0_Q3::4dP%%U)1-"I2$IJ --kA& _@$"Tm2ل.,8ov}GJȵs㦐겫5H|ΧRiD=4#y (%Z,["}-sI( f=?GPv;x LYH0 M"1hgT5Hu3QV'bD0M/t*ađ 8 ?HFB(QbGA{AZG7/c+Oʅxq5y}aӿagjq-dqtX\V0*NjkѠT;(BVA z(% ỿuר,R5%&r~!kB#r \iKQq^ivK <9aL>{dzX㿥y(|CtEɕ1΂Sd}ӎLGK,UC=nIބI<ZN8[>;w8Xëq~M{um)e}bf-ȢAyBOuo^vxm6QiĕMydi5 XWOh.4dVRA$cI$ 8.f^ポ;34Yv&I~4jKӉ $7\.Mvݥ`&d> 2[h$ B+MMk6=f mo?D"8&`g;,U&4`,DLF 9] N88/I3ݚ J#Ai<@j4sKsg7p&G}/ì@jBc Vg]3䬮CA]%?i 륉d]P#~,-SR%R[X<5{ W寁iŵ,G}Č 9zh5(GYϲؒVFs[i\4[|Al O?JTi(?%~jue'} R~+֬0*ۑѳ]ʄ,7P,IK:M%~g7#A5.:Nͳ(yT!kf˳yjZtȔo:S$l Uŷ-. t"{GϿ$-)KvÙ!]bI1~[lWs'g.<* aVMt:'<OFXMBMtEXv9pņ4Tgvj%7.կaґ/}U|R`ǑQQrygx=v:K)J'F|֝C=FA ϳxpdڶj PD|=̅mMKbukҞv<թ';T]z%B=߃f3hpH)Ē* حTuS#=0]wvhQ) CvN!#چNEq?ߔm4DjVx=#grjTS S,sU:qbEj:|66ڦ`\T@nyi1ʠNp랔 J22T,\N|*uPx jBLϼ4zUڼlnkٶ;4zTGg}Ca-+';Rɷ,/;D! @`OG+|*{Fק _:YMKg452Ε`>n2bTƊ%~Şܗh@GLfS'QPt%$_OY`3x)I4%YMkw4`3*X,!fA(Xh@>0iS_z4&ɴ!0K 6| ŭ+MGMA˹4q|0=]dP;v l7L2lu+sEhkT!k ? Ѡr; fɷ%V+VUO3̟Af-ޯ2 @ucc6Up9]PoEivLbqRih³LO8 jѧC33*ҕkPmN7Ӗ5Lt`&5u1\ӾSK<.>÷;, tpΝFE [nnb[-$nU0V{eN.*-_ҁ辘6-\8EsT?ZU]GyԽor/凰[f; ^iLd;JjZQmրo f}  w*֥*{[m>X5IsQ[qc]b=Ҏ/~(xuB~şǣZ['8{e4 U$+ ąB?Y#|R?$R>,ɊB8Wu;O؂MLq౲E :컟%ɇym?<,Ϫޛph5 :ŞKΠrр}w ,*{>.?X+΢vfB[&Vu|P̭ Ҫ)e_яZnI]W 88Ac*c^hU.Y?g;L<äa)WiC'._V:=u/ [)7I;1#dG֫IS ثV3lGe&M.]u?E cv*l@urX1QC{؜_i,˷jp]/jf{}tG Ioo湍V|aB{HXu^ KeZ1v! jueAڜXImRbRIXKqUC&4uӼ{aVtʰf=6)T">ix-~sGYŦ7}D+f -lӿ*W2(5?f8G}-t&U0jFDl<̚,kRub9۷o}j.w=JО+>bғAff\~sű6n kǮdCb;4agyK,GH>aB;llQ>*3;2wwb^.* c|Ϳ$weޱ+d$I+\C˭{G+mݧ)u.~Q[bynx> \$dGQdZwN9Z΢,%DM-W/*j4@aܗ Gc_uaG0r7x|!]JWi>ƚyr?Q_[@<}^ K8PHlb5.5gRĶ~{m}Yxstec %hx!"1'*nZq>}GD{yˊ }"$wW } Ol[s9$\ O}ȇ\uqV4X…AXA^-^߆ ,C뵋ky/zh<[##D`nYމT~O˷,;,Ѽӱ`X?!fHc5_k4ol+O_Tnw(3lI(0Ac2(G,wMؠfods{y_Ky>e䘸??*9G.k`ӈRaa"?kMWQE,Q$aOfoǹ˶,,ZdS+8!\cI0J(:Q-A@R' b-4;[^ԇI|t\wʁ22+xPsVUX9^f=¿lm # }&`dY4vӈ!HB1IDn3ndPpf`6$>"5hϺq]>(΅ء0dh@c!BgE\喊T[iUz]xas lr6pAʷi qPF\h)2Mꤝҹӷ,{g߿+y(oe\b Z~D?נ% ]{zSZL밍VpO"A1I/`Eڷ d9{=<9vvAYlBPjUQ_"69_;f X j,y+26o/5(ibwx"j c]+zkjP O8{Oެ3w^5w\BW=o+-E=̀uR?7~+Y)!]RqRQJ`Ȁ2:O,r^ȃon$8ͼRѹnؼ++#-csߦSKpńu\yr.FǹCz_ɵB O@ʼhճr_|MM=+FwU G XUyAwd ~tw\B =;@|_tilwȳ;$ʢKW"}&'|Ÿ' /_.BwxEƫ+EfC6V4 21,7l> xlu42 ix!k+d#2jP"wo"U򽯗<͙MJSG&iwgyy19=>C˅r =o.do7R6ek:nݭi#=z5xcҝ9#_V?17yv7Nh,~u}WvcKbM\YWד:jm# ٵ6-}l :'ȝϿderVmeύn3[g:g4Bꓷ۶d! VO130[GZ5ztwt,\F21VRJ3dMؚPR1v8fɵZ@rrjn!+:R!$7dH^iQq^!$674qxJxͥt(Xc bn?1?ڛu_bTsślzS_T9q"$͂~5÷ʋ>ZtXu)Sׂ4ȾE䖰EHMݨI%Mk;b`y6-Qa^*i_ֳ\ZgܟZ~d9;Xt9vKu?!UE7Dž8o5lQeo8 lY M> ٦ T,Xg9r6厭mWm9,v$;W_$bT_;!>hsztp /6п%.(C;O)Mru^}1{O{4D^1;2MEn&VV\)wԜPGGꦿ%{TE;MuAi2̈@՘uqA/@_@sB'2x]*udLY,~$qkSLAk]MOabm"5^R7"-OM/L>Ra/H3:3x7G9d4˶+ inTKUZ}p7T޺S.~CQݜX<4:Y*@Q1@ I9ܥp-}Vimpk y)4DmHwV`Rqr}bfUj]4!{QEiS~Uе@PiBTTBMLtT1ugZiƒ1v(9 9oƽ+/œwond/pa:kP1RB| -x0lٱ%IbR)e`(C<R9UXTQ@Qt/R$2AKi0kFoj"Opm ^(ZmhW7U6Cй P3QEPR*irfuYqjmjSFYDM 3hC6d3 JEHň O-)c8If愲Om,utmQHɾ@vbo0eRR4 Zly,YUª _JJ0ҙoWU_Ifߑ~YH(4r jΒY`# eX4]?>oLLyd9 L)B;Wd% ~_ D*+*K]]Cf ;ŘF^tu42sRnyбB'`v{/yV5ti" .O:Y#DQ]]GHΒphDu7o9 |7ޥ免P i2u>MND)5-MP9zy3|H3IUEej `(Ȍ[l@Y"T0j`m.- 7__?C-{K?~P9TiiR{T0Hmf z hZf6%A'3 \%&-a)FT9,* r #v?O1#D4@'=6inE =Zݽd , |\i"XՔ$"0n,_{׀ey@ "v'r57}[8_8T0ulo}%.\Z=bo,IWCcdBƄP߭fZX G#3̦VO3ŵf z'k·e)vSGT_'b<{턧.IS}#dNJp#tyڟԤjJl+ |2C()/ty=X)1}Uuw=LG&S5{&vb e%־%h61dsEa3ah2!Ya;e, 06gJ1?Бޞ(2tvn.e&ɯ#t^IfmʨFmh3 R/ X?=}8SaoDUv @@a-ԛ$i+FT~}LA.!J7XZTKZxI;ry6ylXN5*Ng7\ Vq:]?GnRnQNT6>[vHr-%m3kULy9:tĘ?)RmGۻ/oNܸ ~Y뾎gu?@m_C+ߖhC ES)J^p'o}jgSl%.n}bqٖ͵oqp Qj|.05m._Z,)0+,O7͓D D%/;fxmSC /o:T~l/`LמQ梣H|qZ³\94]Šu-}REw^qy%)3Rir/USeYXpU>>^Vq}p^.?e{u7_FM'J|xqt̫یϗnL-mγߚ82*DNKC΀Ȃbp]N'f":: >Xu:~y]ܷMc-kL+N|bڬ0E1q+(>չjhڣeLOE.9dB)$v8 :R:6;0Bs×S0϶[{V"ΫmAVMt!#yvݓ%2UOL`HքۘϡŲHyB@ׄSԃE]ӹVbc OgvEȌ_l>>/:/ACiaoOpŏtI8=Q$ TJVߞF oS1fFUBRÑ77}M#r[51tm[ GryK쩈A <0nТ3i_K#Ϲ$ Έru(c+!Ғ>˵k%}eA>x2r"WȂop:@QA}-OKRp@"dA?_gI BC<ձ#:M~|_h <=p(>+,[I<N%jlOܱQ(z"N Dyo9V*b$fkC{GZ afTj1|gVּ+q%֮LŲ[ǵ02wxoSݠw~>7Ceah[BbD*Lswx f}3}vKdTIUf_7j䕭~#+|  Z(܌RMcCy;>?bhEw*'3ivMMBd?DBA;O%bXGz{ Q޹Pԓ/ù$.]I_TKNu7ADVH6H1$EU@"IY H0jõ 7(&~ׄ՝,)V9E"&HJa fyVowX^]N a (@ͤ3$ժb2 h  EHy-j|oQ$X>=@Hc)7͟+WCa@N '[3F`o0JN-S?PaCgṐu[w(=m@ؚ] <&;^VkRgec籶1;UF#__zOe;ah\?QMTbt[ B7YՔAr"0x@eis.Z坿mEݢ]dC,[JTS4q4W.(.u#|f-%mkgjU[gN u`M;DSP?/P"!%8+*ꪯZnOWηU@ypOea\ L0Z_'"DE!XY0~7/Sr̋4H1$(\P52j٦ra֪x0^1ө3̭$.{8UC)$u%Įӟ?]mZ +Ӳ}ِj}d.>_?>~/:~oO}:z#p닷P F5ON$T'rkaJg{һ4Ei5eBS]UDPmO~>'JhKnLsvw -gxvAsQUB Z̔N#_&V$gp®ԫPRV%2"1)f-RW2)=bb"s^4pW9b+G1vYGOq1 )Auք;N>rˬpFq+^:9^c\h Sڮ/Fpy@Q٪0kѲb~-]#&.U" zäIk=%Q3QkMw=C a|,Qs=#1`Ȃ05\>xј$k:l;йyf~$tLczhEurU?{sVjx{MV+O௬yF;q4;Äus1|W"Aw4WTLNg̓ەudP"|oI:ɠ |@IK gupj,%<}HhT\v`4z.g{.s_wD`~ׯ^N㨻h~ټaLzr@nmHi0U椶tjl L W;䱠"3d05h6'!%7HJE76] M `хR'@``)td oTơ ̭6T) P4^5H{H\#Q>.qG"(`by]((9 K$hLaZ, db˫lr-`<76FLJQBO~j}v?Gmhݚ$ D |){A gW,ZJ_DqvEiI03"pᵗ(Sg Z60vQo_2B_U5 avףj3-bw7.^sꞁV/#)>=Q~clT A-.2/~ҹXZޅirOSDpȒd#7R#ckLl/ـ~24}wnL>gף݌8xTB[%i1ӱeIW5 ,T.N MBTtiP6H 7+V ֆIDɍV _$e' g@A}rVj/z}B_ѷ-JRh-ך *G?l\p@'DRWK9JIkh7(|OsF>Kwg 3xٛh\hѝkAp̬Lxڒ"C\gf9Z|xoOW;GO ݡ)j”l!$"f& ,+r HHA#|퉄ǃGl9p":+ݬtzF9ˀսb}édp6ybO{O}X<rJO'[S/MzV 0[Qw_V34d~Ƨ34D "Um45fψDPEΥug!6DJ)I~ LCak _PϟXܼ)FN}5->׾땹y!oWn:"9y*0ic;y/],M%Cigy;z򾾰y Cg[y ~I0uSk{"-#]bwZxT_mn,y_t[Cf|< 6*RF1Q { @Y 7%ee~qܤ)B1;uY;zHS,E rK"BaXYI_^rܯM15$R 0LtItD)((%>C@9k\L_.w%J<=-~S'h'Ƒ6+:ac. -sRnuw`^ +ǵLH$ÙP I軯W@CdC)m Z P!M!?On$ztX -ZԤX8״cŶ'˝허l/eS=kIGI{E}sf{F ;)Y9ՆbRiEhX^C;R[GH:"/֍Sb\aEa~^GR`Îi%ߵ2'¿4{-'Mы=C>]iar@"ܐ ƽVuaTi"z">xɖDtJ"̹:zVoR"g:P}#&t֫}/!~lH $ &jtl 2#%"D?^~-x?96zR}<&B;oر90N9#9.ZKÎ Y}1ra?ۥ~+:1[eZKKOXׯUmxWU XFnԊFVlXxΖ`V7ZѭgX^Sj*S(ʘ)cL$}U)lbc]T`/WX5jYWRW"(xPJ*HV|?;?,FF6̴i -;uybu;g˥sVߊO^_*s8Zb' B\0 \ur"1ok#ZݢRi!'r} Ickn?WxQN+dI(W{'3z;G|^_C5lKo9_;O%z/̈ye-dOGֲ4t/G~?[j+bHGi-\Զ'\~oie?ܭC}.z/_sb:/c[l*o8e|i>t1gNwԭU{=+_q-~JߝO_'<ϙy$Ouw__`H?*F;?.땨.} U}iu zoފ |3Fݱ=?=xؠA%*R\&HI˖QEE?zǏӴ'e¶Zl,Z7X{oA|/1c5;:N3BbF*?o ҴIa\~椟%F$m!c;Hcn_f)ܢ_Sm[h:I?<]Kw+>́$:(w(!uYt6oq[{|nܬ y/oIvI57vcqo[J!0WYq'-v{_|.ǹᰁUvF^_a>N5kx׌ؼ+oX_ɑvŵVU.`.ĈeΔp[jՋVWo] F%42t"4l@*y#sYD1ƋXZx:I»v tCqZ_RdЏ|'xR-&<qqջ*Y]i*gPbwVHRt;?}hm $p4LK_>Osa3,TI=lv33~m{J=B%q_qؒ;{Hg1">67X t t̒i,Uz{O`g~Wu2&Y穎{w*WcnIk~O[z>B#>$ɏIMcĐx n`2 Be ١]$E*RVݏ2&q@n8eTa&nFv \_QdF$ALh&62˯ũ?<*E =..1غiqj>#L1KxD(Pr5nb;f!ɳ/_J휔OVUq/TɱpB 000=v8}%uUN fT/a (kxk_V]r8n tQ )zm%P@5 U[`6"T(Db Ye{Ϲݮb?둱Ez4铁 #۪QwmEEﯱn fY p%E4R$f"R4 F`h1tIDK#a)~W9^b(7%g~YE#^uJ dShV[vKzL0W1!"ɋ Ll1W;cfCG!ŸfH 8^\ƣJFe mE5lb[#PG dZ>úO(/=Ne*ءHe_$-__K(%y!LźL$5%rl2L&2ĸ!3YJlX$Ae^nlgR͐|Uh6Q\٨di㳦Ĉ%s,h;Wn9e;Ե!>@h4GWO6ۥ.3#uGUmuqsc%'CoG׮?qՕ3sur;B"9g k5 ,R6F aa\ ]opo[wwG6p9̞R2l$+> GW7_<>J$ca|ټD<O SRJ#RzDXQ?Z<}7ՑOaw|RTqKjwDH*=9sR\rXc?ϓ?8~G(\9RU<ߧǷΥ&kg+%c'ۍ\$_ֶJuJWY+ܺi; JJX42HRcw$ ds˝&֬ } fBQ/8p-D,G5O ]MR?Q_ji{3L^XjQ'9ujRjFwabNk8z],ݿ) H~__?L<2!-̈\#vf`Sm2Q A3>C /5kuB~ӹT3~Pg~A<1Wh%܋Vq2BQKkbݿT,NVU:J<\k(SI~:ȗTtGdbwE&פ`/}!irQLG}evގ#ԋB3ssbJ01$ZIjW1@ P%nmW7|O\C ~l qPNR"i6r\'V!sJxJٶզ+8OC,ܢJT:[+BX('y)-ICr\ϲqvПQYo4Kw{bE -J׳$ s^[c^s2(,A7Kz#Uc6ΊA"*wp&^Xckƃv$JbV0F9E -4ܠUL*rlYe,iq+h$  nsd7״r&p#[3m~?Q?ѡ1tDJo%Oe^jat`Q4~)#h=bdFAƝ.8 sNSyD;0(|6^y1CJ4}X|[ǩ)D}J\F,!HY)}V8S j4(j|CUj2\HBUZMGmkmVY篞e02dzsb #N׽=:fA  MYAcj/#U/FmLw&36Y?Fٓu;y"bpFN;i,ZbY=VKg#T==Β>z>[ֱ#:FvxKUp$I:xNg:iѳ|l{kfq&2b}R!զkCqXӻu,ّR~GĐIW ȢN^$+0KeL+3 Ƈuv4>a3Fp#rd>OTI;̆gTΥr@sQeefɇ+o(qV}Oƌn%Rn!n 7&X wiX8Fw *3{ծ-VtR ;''inSMTPĊQooOq=i0/BF{l m$Y' tUa7K^XдDq݉^¢zE'rϞ$ Pm$ԥjMK2f)B`` l&Tҍd0"āLB}_oJJK5]U${Q6B8#O!`KZb?䡛%B2Z"߲fV(UX+2ǿos|oy^s|ǯq>g-t ,ȬcjIdU[5rХUlY|Kf(ԣBڴZ(%az%R '0>rV>ebɝRe$Z-˟. /I v@#r`ّ B 2B6G}|_WNJ tB*yC\j3ΙcV!#JHJ⣾^_m[0J 7"`8{,/qɟc~g_۳~?O6ft甜uuT @Ns}8 SlVJK` ؈683$OY׊ƓgNg*-H<3~롉psʛ:iϿ:x(A*DI'a(y)!9 m|=cG|@Tfx|,"z #$"1q3PcsmkHM\*BJ7,lQRhH H]dt $Ik@H#ry"-5$s x)sL)+0[|/k2G;6akcSj0E2}[b4٭̶boN#c23G AL x@͛pT𠤶 sTc c7\ӤD>y##HA jvNg=q{>w$]6(yQ ek BQg?C~O#o\nӸ!TDZ@8`] ΄ m-"Ӆ|]_U8j̣K|褳HѴޛ}4ȑ@ ??Jb;u̳[a1kUyC$ @%7{e\9*-?PG7y|vxJKQ EVmIoONyґKl`6z?qњA/t YF+Hc-7GF7)Rb oU{#'v:n~e ޭs_:O*_A/U,9&ֽ[CpYzk23Imxe76bp084Oq,>I[}_;eh8:LO\ }[˄,l%;^/9gݛgֲ%k DI?ZO?ʴ!sY%85_[x99h32d$nѓ4(8 BFZ/>r;nA,CҋP [e: -mPcP|i vn7ݽtnkϔm=- Du:Z0"x_Z+Q?@4'>8`fn SLr+YʹK転LDT[E8Ct +o< [ĥ?>PϖQ.=;EmFg`6C\'eݮ:=?ܾ|~0^.''O޿8u(c޽jQtS.WgwSC#[;dw]DM(hHbV a~ {Ce?ef(ӧ5XnpZy֐"@ @4+` k N[b3ZY{xܻzR+vGUmyURB\;LE#R f! =YүscP45cv,O ]~n,euy~NJ3kJy(۩:Hr߽/ ‰ |j_ja|I]R`f}RI@Mt@phı! B5 WZWw p'mu hJ *jĹGa?Ivʯ Y>[BP)ȥ%nOwܷs> D~Vrvv5$2d S}֟=Gg&!d'@XC$3+ i96?JI!g'0,?K_=*kz,M /4Mn XR8S ٰ`d'w=sOoc!  &ygayjgPzׅ@gMD3 w_l#Pd}*%"#D/ =ꘛ*>q&$7d;G2P8PxHÑ2֒sc!qWIOCC;;7Y_,FּIEZ IrR#.H;qB丕_#wrleҜQzC 7W{`u&d0 LAfCx߱ ĸd@yH.[ݣgxZ餥[k&vu$! AdKe =ʢ[&~oѫv[s}@ãz*!F[LٕMK[Ib=49_~9kcҁ B>)ŨbИ I\(V4)6z' ZE }df5/`Ck5*k㧒ɧM騾€* EWfoq\rDihR))muOK %1U:/`t6WyΏhS&%F ~oi} e#1OxL{H\M?8Ӣm Jzވx XT]D2@h^߃4_[!;֡4C6Ѥ.H8 `0I HuNjDFLqqlzWF*ҷhQ*$d w?~nb|Mo1E(A L$)%]UD^c=W_HӔVZqK#j>V/ !jP+ RVz(eu 3[0=idH"jTezzla&T ah f$U'vcHƉHDlXG8,h5<ʃ$Jr$eBKAގb̅\(?'kQOܓAe)= *plRLjQ[laT6\~ o-GogSGll]{:ƺQMy6SuApK0Wv[Ga_}bYC{lb\ܤ%b@B^EaޞPʘ>ǎxAtH0b!>/NQAS:|//Ϊ.1`4oի{qŝCbH, 6FEU ITAZ4hֱX5XbFbը(,EHCfCu!gd´:X 9YGkO8^<ٍoQ.ڹ3qT+K? zl9 >=Z {?Sfr+f嘍#<<)ܗK9zQ!xdZCli7ʪ{+7<x.=IMmtHuw2-6z;ȵBa4e3ĻiKF:jɎO}VhѤ/e̥?ye" \Sz9Lݻ+ݦuwp)Q7>KOe|*ٺmK/GyGOЉB"B棎 H{w>W:l}'ϴɤɅwu !*ocⷉL ,|.ggZ9e{{,AH&>"B0JtF^ULȝyLPrL#r RY ˒j;h"bGsPaC+z=sLܯsʮ 65B vY7K`Hĩ!JlHՄв3g7,m{ ćt3;E72yl.ږ٢&˸e~kCِ˜219IRk*1!#X&kzר|P(OSF#B5PgwCCۮ|u@tb"p5륁)J!1[";50n'K;R8 UOߑJav頀rXsY}K+Oly0z4(|oV0e˱I"+ ZFֶ[,XA`wfdz@^Kľ2P!Bq NjL@!aiȉU)Wkg5 WqX4eP03_o;.4)aP #T@8K2!2TF,0m_ƽ)ک#|7꯬G?vprM~"eUgDl;T# v֡WPD9g/umx#ZxcIt> Օ?}uWY{B\݂eԻ9G8vu61eN'Έ]I9ϼ/1dQr[~>^@>(,^}ÃëX~:,M[|hN"RVP'Xކ ! AJ#"$z 5eDUVE q/t+d{9k*{T ^1U&@Aي8ruVHWhb LpǘXhAeꡭdnL*I`\6d"iГ:TЌ%On2ӹYktMfHz;΢JCaSmņC)H_  aIOZ؂ԙT #ǟ]bX-!dsHP@ $<{mv#S &OE8}jd !!Ƅ P)ɛ5q=8ngRQ2 ]K3c^U70IœN)-KT:k10Յe] P X^%bu&hE&DG '3تK%$mѳeKP[*z'YdJε>H$(M̨) NftgEhC7$ۤŃKN5~,Y]m4V`SbvEh! ă`h̸& V`3ԩ+IUNAm&Adp@;szXl@eT5`2ބ X Z`Aa90I2IL,PB"T`'#96In-R6TH64{(#q(]5iePhHjIEqs @ H*"ٰQEj;`@`D9ULYM)Ta`0L)*aX(@]%RP1H$pׅErdXC6Dl8P侼 #Cf`do,BNZ3g BEvة.ʊ U +sh5tP^@#U-0Ur:h-PT(H(._ሱc|3:B&UNGWIUK-C'Nˣ깹Y}=Z͡%=/ߺZVy}نRyr<HQh@X<ƓՃpJebЍ6) %9?"|zk='ΛS{ SV>nZ7E XVZw*'z{>i+}IR$ S&"[ek}70-|w;BY$'6_n涻 ߾?hA2HT58Aiɡ!l:]84ρMǵfX8@eş﫬u!e"AH!Ig(Σs_9 /j?:y$0yK8ڛ{+0{Ja9I2$J;+˹t`Cz.%*\~ ?yj/ H4zI5$"gE:Pi*JO PúǹaVnN݌"}yN^d1IJ9FqDwW[z+?>=50w§u)2PUH&'< fGEN~9A<dh/!;x exdN}QQ/F*DV*]qk kX^\0A1QX#XV-:t`]ݳ2r̨*…5pUawE]&Pxo-yQ@iṈ4 \Ms*;r1>yM. ;x΃nsy3ZF`l`u-UQ)V.~xqNvRLW1EI$b]+(Szs2D9M'ɱ"ŕ++W%ɘ NF`^V0ɴs+J~Ax9h3$-#c=ҲK) HLG^M;/Om7fݾ!?&yġL@IVKw , HiI¤4zI5YPI@I!+DI^I!,I.ޤR) f ,*,BK!U DQ DI DKZ`*( =^a0(%DH7/%D r( /{0pK^DJ` ALÃ0Dl j*CrH3L& $ D\"[ ,B!-! wcԷyͿ{f<gPWmږRh'ZL/V~$vs:^\Bd}9>7BpӿqO?HYO 6I gV!nAa $AtYK$Q)$&*@ dRªěm. &ZW)z堀aA !01%HDDx|}'?xؒIEB$!Jfd0iΐՅ(/ѐK]2X >?2{V%*5?SNkfUz4XZGec r}ۯ_cSoKf-Y6hPc+3!;ڱ-#Y1-j~:SJ-QWU,agaϦ*>Qy2jX-O?ⅷ{V4(vw {'+s{ HE$#|_O !ִ>itFAG[Kf׊|0Sלh֘ __FP?VM:? K\U_γz4qkM|_e-9c]NU89=S3"˰enkfomf^ѐUKQf6cDOPCr1d% #@ "bmvog Nfyp-dEړGCcUܑȢŎoc?4GP ږ:6ſܛ%%ͥ &)$ Bû]_ )8䋭2XRh"Y u5?)!-(l`U+u1v/G/<>ϕ0L2#hҍ35}I2WbD'fr8(m!ю偻~݁e䕎 fugs$ލvnM_eT&USr)_/ ޫj논[TW$| Uym(>mFzO*;ͦՋv17a99M,b;5_(aϼqg 2(JMؒ…$!SDR !lYRGP" qFOue/o4Tџ#E3ǁw)oz!5#oZ(p)Ȍzh}_ 5H[?)]Zj-9@< w=G|z)@}&ǔo]4zRu˷ݾ=~_@5|.}O`KHC݆ɨz֍ޝ>'_%u^z|&̳ cיw%N&G')P6c`{$C,R%Fon+u 'A &D!+rүusm<^ #}v:}l4fXlYm,4yxhJ=o%jsשwbշc$y/tniqޖO֠r L)b D14Ex-  md5[e>4_3.^%HJtzuBt;N%󩽼x\wq-иFw|˶x [TEKUmx`iStY543-NQ}2ڛ#=n(07z݆dڶą/Iw'H]5;'ޤ5/ó&}1>b=BUEJy7[ ob  fn S(HD. ӗۢNTA[(9ЯejfrVf@Z<%/49dB r-gonL~wsooc x8QsP+ b<ŕlreoM!| x#51ȶyox>߲pԑB/#29/r')'vOiyX "X+8? X~:>z"z:Ʀ])dB[c9L "5Y$0eE U}w`7mfv3f@{(RwAfLq!-x[_z "l EdSQ~=hXB ,|Y㑍ȹLr4l;DK (?@} n8"̯ՖU2"LX﹒l {4șH@*g%On$`535R1E桹ŕM9) ԕNJs A.lVSi5vzٙ(e7kjy{&V,DgoTVf5;g[:a,gatme%xw{\]k2}<3RLF4Jֽ-l9i$WIJIY-S{.xBw'(Ѡ|S`9%:> Oʣ $"񜨋"bd;u`|CmȸˀгZc|^/Ҳ8"^<On'O0e/ಆ s6 3tcH--Y MtC3?G_~%yfE>Lus2CmNTAO~;ڇ=86W3NYOC+tkzwW'2sPMLr~2d{ jK ! ΪGA=}N{O'QmԿ~%9/sYgE!$'AIkWW09W?`boem и]$cAr]3uH`v'{#I 6d⫛#.Vg H3fn(T)00ޘ v98&ߤ`]K@!FM. @ 0 I[h#A=wV|s:!ntwM Ф.' +A,#)LdWΨ2CPvM*Č ѝU4*bxPL9cM0vaE\j.8VT׿jÀ^R"bo6wBd/>7v_go LTv֛]# EJZP/BÀ5Pq؊[2zR.!sơ*dTL[ z[daPqTʓh M%"HYb<% ma6< LrX6 {/7 90J6dh卽b#UT :en6w[^8JW vSh7JP ߾l~#M4Il0G 1 *kFP'֟_Z~(rI$QHӶXJ&Q*ko e̋ (d RPGT(OXY< n ȇiv%Xl֯`uw>q{1z~Oj00g!U߽9Oφ0%e̼ J5B\~⿍a*Y(Q`f%&k7zCV)U%UBmS?CyU%IL D+ʾ-ЋaM̽cp06ʊ;Bl@n  =aDXqJd&D=ZZP~ )R,{S҂p%9"d SRdDGjAq +`%\S,T1Iлnm_[}?}Tľw={HaŘBM GBL3V8g!R=ѷM.6A懟~NAOdM>WֺHid"#/tDG%sX̳&0$kP3>Q@#oSLn7$EX|z㊐J{E.Wem m YMJJ,!&9U;-fNgUxwR@meZ(2d7Xl9+aJ8?䮗~<9W i~~Pr4WHh&r-sd!EYjfYʫ+YF9yRd`])axѤh> >EтhbW 6PmZ:JX"7EX)WU@$8/oҾT @]o/8z(# PLBRt5(hMi1! '&kc\~j/j օ iu /遁?YPqYՈN=Fa!)A1մa{E`\Ma'].@Kq% 2a)ǜ`.j_b(!qlI`JDIF)ҩݢ7(ADAJb$UL[J`n)bK@ QCdf(HCj_b|' mjL+kUIE_] Npp2qG7xH??jJJN`cJSPAݑNɔɩgâ6= +yxj< ,&Nʞݒ@k)xM^MYU1d4ȀElR 4F]4l) 뗣Ui'`PqLYt/ C!&[MU G:%M(\!Lad ڍ|kܶۛmtڵiKYSD7|9nVCvjٝ11pcj=P{h Vb8"EaNPV]S{w|V''4x:I5!Wnk)۶Tnzvuۺ{Sk]vnUׯ^eo{nk&ey\OQzMo^!7v]4ZB,Z^knyPh])%h.dM\m, E˞N%AW"W U\>럻8 {;r֚߬K+?2zbbVy/Lj?zS؜Y dD.ɥ+qffb ;k4ӷ_c'/-!wB;]觬D={z}JEfpt\ְesRuc&)CzqGόeTJtsZJiw% s,cj _x"e'6XQ@E"hQ@R,K@H#!K L5n].5eEO+tEk]ތ,@d>d?#U{w8Wot鬬FӐ`>> 333{.ݲ;UE'x=uFbrjEsR^t]K!.0C> tDtp# ?o%_=(*rgQ%.&nNǥ 4:'y`*5tQxM@DRB{m%])2#Vyh9u^VG/Xj.9'P+dtFNqC-j99㋇,_-8ddU*h4ĮG$[?,Rio[}]gy ZWye+VySxAdyZllx__a>(; iYm/6$+5ۋo~{~R2K<i'.Y R1쭫t /iJ*,CXBweÐ i<2\!uNےnaÂFݏUu}mKv#/R~9NO !,:a7nhJtb!)ESG1*2cG?>eH)CY2C.#(k2&w%sHm#O єO_΃p̹jpVK_Vzj^o{sx $mD]ۢ&-ļ[zX{"po3}bk<{)"MrE-Zґ'`3^#"qmN‰h'FqF HjdZG`C(ӶF{A$CHմq#N3 v?B5ڗpu5v|wTzpH^/V"7 ߭)i68u 3?=snS9VnEaX5\B)/u% UֳHlplS [X,]7*ȵ z_2z4;*La[ 4;Ats5jTOvI28_ì0 ꝫԢ@.2ؤ˭e/_2LM"RE?ˋyr0=\s9{Xz8ZscF":(DXx;"߿GΒfgW5wy3Dv4K1D,X3 ,mgG\JZtմxz}[l o`[jGcۉqgÂ" gE>EJux4(?De{ᶵZf`Z7V;:9Fw  c콙۔rx\7Em2g6˯SFbąRڭiaȴ'Aju~.i=TzqQCH vIoXYCT1+[lƏ͆+Oo>~S{^CNV/y]Fx?9^4^bb'&Ms2ٳi;U~r÷Clu_#Y#k5TЫo2egK!J!ʱPֆz=${<KI_{[i+MK%p]#{YaFMw0ʑ9T>aT]XihF2rovv/h79K=Ӽڎv5A#@va)2w\/^)BQBcs τn:{Tdqp)隉 Gv \7D.пb.1Vbq=ck8'yVh0< >R".vK/ˍル۽iVkva6ksr :-ۧ9D=^ z^466b<[5ۊcz6+5<}2|^<@zQD9C{{:u *@msm=[zk^ۭ{zWUzvojnֺ{vUkUծz퓵ڮmꮯ[ލzޮWާi׮]{LaB&!n! zN=\^]{;O^׼F;;Emos@)X}gdksA,t葙{-t ƀOQlaIPzF‘uQMke6PT膺|x=𺖣Kj_,Kt >*[~Qd0"][۹IGOڏ.(z$т oqv_ՙaf~ı~ەvt3ͮ޻}OfId,la; f$3{+zG^ JI*uS0ik/ÉvJ9<օ+* Ke.,k}|^~+ #`| 0u>7ǰ堙gykƳh>fZ'{~͏w?Omqwοݖ%>nk7g}~#ޟW${O}wx^S_m}/2t)7_~7⣿p-xD {.a*e:i ]tv+rfIdv`o@IM#st`EP$őa?*N5i=Ӟ4Hmv~Hi ~vFwkjO LZE츤%$!^8FLUq6X5_BK=_k]۵C/.!0D w5n"m4,-z_5$V<IB~÷PǿJ5r[yW(Tټ˒á4nȑT͕P[8wv,c_gɤGTo,E6܂LVG*dU^3>YhlŁYL[7Uȧ.jǣ[6瘐 ?!(r{AbLxaYsrg?vz20Ro`Zg]aVd Ib$k;~j:lTlxm4fmG/hUu[QpԱKf eXÐj35E˟m1je UE-ǩlO6Ea=q)RaVUPÕP@Q3RWcmi mԃ!%l QC|GE.y>A^fDWƟĐ'vO'{q@q Bw%2KWqދ0. j1[elR/8 nm|(#f HEC~=c0ΐB2IH̄g^/hX%$rK "K%@B0%`0/-p, rFFB 0XB` $Y o%c -u#- ąˀ]K.\ Kťe ikRP7 ۆ`J C ) 0D("aJEZ]tmWgп-$gĒcĿ:=1ȋAx#QMJAlzyxWg/O?o9uN?W+>l#`l @|SQwya>8E<{տn{^N'8uϵԹ=J#(*U!]{|h<3W`I36fCj6,lQT>_~;^vήŷ."w{[3wyǕZO'? 49( M;ZI#t}{mWYex uuLk|~ j]<>LwLC#!;69$me*͒dylgD3%%bND͙S>md|nL>>= JtPX&)G*' 9f h}gM&9T | ծr;d#%ڙJr`=#zmw6.Ax=Қ8$EK"+:ĕwD(n4T^Y" 4"^$>IFKCܸݝ" C E̫U~ܧ X2Pi۵|Mx{k) HF⾍cz'ʐXUlj"{]-IG3T}=*=w_›WYen׿guӖ3WD&4rC+޿jr_Vx i^0$!ȴK 2î& ~L8\&-ݢ M;\9q^96|ItG)IlU;i|+-[/w',Kc?᜼1}h}oEVID>2W3(J#D69m)qBK:_[?%^G7^_AW '<'C$"uT=VVCFψuŽ "ͭpTqva_vCD{I[ ۇmbb )f}Ayx*a@Y8'HIjTz3fIƂ$'LW;GY@瓭jKZߝ50} .[-s`2֌5%arF- r#K.h,ɟge:b-bW6ŝ׽yji5 AИ>@ Dp! Jp a,"AQ(Kp," zEUF0ggo=yVOױBw2$D ~A<'%? 7.}Xh6ܦ}A}j#2'9#k(@s^zFݏxc ̩&&Rwɨą(RV Uj%?蹋K?h0! g?Z ?_у؆&ǣɭ~ b gi=* ^ZYAHs: U+>ʉƜ'Za=F~aW'=(fX]eY`<^˴S0@D=YFܠb4FϗMӳV ڜhiKX'75dW ~my797Qwj ͣ!D*hU\I!$<B3_3pJ|":skYAؒleOPjsu_M{y4 .Ҵ@a80"~v?s/{nw;|ȯ3\]/+F]9ֺ-g<_=c@gQԇ}G7n Ž:,\ezϐx}Yo'`5{ċc%:Uv\N7;XVzaHK# 5o?O.%n*Aet_2IQ΢sxRz~{?wXnka#(ld֕Y$GM쮛8zO}#EOJOb~1QDQ/}nqq3K ?Cm}% "2gZ_ƋSk?Dxqs/G0/>H0y>1;^/UJLjqwʱ0N t ,'o(7,,4t=ˬۗS D$!@{%$/xZ]wBC W.VcS/F휞[>ozN|+Mƶ익$GE9;Spinxjgcau;Gf#j_,>ֱ1226,TD{is؏ -Ubi6 "2# %D9I% x_kWai?Nt}dzЕ{=ѐDzld (FDDEf̂=-'J0Iً{\~?z=n|p DU$gk[+ʋ`)_vҪ\Hzyku遞P]o2>Ep +LA;@ D 9QefP`5 3GDZo3xי\Hw?^?/t" jWSf[*I:f1nyvBuu۳fG2iގ%2Rt',w Z6ar +u8NكAg[j#hkָҏ9b2E[O2cJ-K5#vuoO:dtEtЎrAȨ1b# @M#0ᑎFLqVﭱz嵻7=6bؐ:TD2?W)2mo⼟PSy+sd54k>z0K/H"cIY$P(E<%$P_6[m͹E}-c .kΤ*uM U&$:;%KK/?s!^ &ypnbeJNm)ff7?6ArB9`'`9[M=LFzo~`ڏ_ۄBYG/,.X[A&ڪR)J80*GuZ~~Wy^ ocxr;[_q"P;?[!c r(9E~FK羚B+;9#~Ӂ#}nnQļ8 t 58HHIIH6?Icoz['*\b~O2ЖgcWU1W ?@͇1)3<[~em彄Ai+_Yd{ʨ=s|k~4,o>:ݾ~ڔ:߃oQӸt~mDId- Lio)Ȅ9t Fd3O*?ԛ'EC}7`F\bbtPFA\BǕr /STyS=E&jއ`k]^{<=j%Wojj[4|zX]>zZY|hEF-b R ycgLx-s _u'W;C$;X#"?ťZ ηK¶6ɿũSO4}μTzII@MH]'7m"603M kT]s)uMou-*O{TJ*2 +&Iv"K jK$mF(aJhm2=&8j K+kty4nNbHI jŌR{:,iwpKk FiŁBl ӋYhٍG .mwdv(.j0foIH1bi5OO|9[@k6j,pp@{+)]u3?Uy8|~V^65BMB\@P2^uOnCvѩ,S!p k؄/X% _W-x^qI  /+Ԇ[G8[!+-OUㅿ?.N`WP 鐀(Zw{)2" WiTe0ĂKF3{^~)?[/úʫ Wq46l"+P*/+BE}wמCurC%DOI>zL38W72Ƥw2}CB/$M7|`2"E?T *p,۰RL_w]~-*@%Ka坤 adU.5RYCaMT TI_g9? hEGN,ka,57@@$vM-624^m)@%e oTDi2ґ1kοx仭tyJyrZCj-Q]6m]-Tsyy#v2 gƍQZرbTkFcM-EH2@ܫs1k"Y,H %ق~_h:iai8k5kKE<*󢕔 )"25Gх`i=O q44?;K0w~ ڰ71a `(s-V+é;{=^9Bkbq/0DQ8ķ(;1+ھI-nN"?U6k8s FKƉ^FBܛ>kDv]wi 4H_# 2Rj7Xs9T &ݓI_nκ%:)(*EW0[>֏iο'Em#Ў, גV!P~ij5]!CYfxy KFea:{&OEc]v8sS >u5DaU+U!̣X+~ okUz0kTX%e~r+VӁO *}"\COG,R[Mnq iy+gr\*Vi<$ࣕIH lL m]M$ʀT}C/c 2>2_'=fF=Ђ=zTǞ1P@r5PWѤ.l>Q^up޷:i @ܪDdRXajl{jj IJ$* ={eei¾jDJQiXR (~0F2F*z~ ~nXo Ok>Os+uY5w-. Ӂ\wK'sR9 E\r< 쐑i"ZƆ ʺ捍[>k[LI) RDΏ!E{:J#&wci EIɽ<"Y3`ҵK9T>qOr?H;(f9ZFj>R؊*wX$ :j]wܺ}p.CMXz+YI|.6񖋢 A}CD?b蝚RFn ө &9si5""^!1PGn)YXeEЪ^2a_(I-MLGQDuX\w^PIVaQhgJ? `0>]LLRPAxD㓵=Ĵf8P&I{]rZ.򡧾U\U]{Z_[CVϽL{v.61JKƠ9Hw9dC.a0!'OR`yf8 W7HK0 C_zkoC9̨+RmM?/S]·Zż FS溑T($ҾJq:05Rko|ͷ&GG%jf::⸱8.Bh Eć"x4߳Yoխ>jW}Kva52mf e] V,MN]x`TWMاeнaaJ 5)i7Ӗ'1fnL $E&)I/ˬQf ?Jg:fLg9A wwvh^  BIl.uݖdN<\ʡgo!e썪gF79s ;Ta\g=S6C ޮ"OI2OK@x\x+K;0G i]Pc !A ePGF<ݱ[☦;wLv9PuYMu:J9ɸy+mۅ4u0b'bbtʁp uxY@=7>2A8> ] XZ_a+:wJ; 8*KQ{RQAJ!Dm#69(ss()Q\KlU苼9JEMnlC}l_]'e9V,ezVy&qPHi\=QAL+Ja2{ROg(놅'r-=Kud*?kv߸ nV4*^3>BS%r5 Ȳ0]:f(Y5utj8>|;x:<{y^/lҔ,M4 W+9u$&--s\r-etwXQn]:aNtsS\sqK.q1_?ݹ]er]4Nnj&tQɔRLl4ww]s%S2ȐReq+oz,谋;;ݘSKVEݹrhUQұݶ,cXu';uG;42u54ЖKMwNwo;run뻦ĖW.,s'AIquf)!wgtNvJQuwJSl%JesvɶF4m4hfnLW9av-ґb~WyF 7'IʞyRD`E؜Ú wNKf>8 =OyW/Dݴ\&Nk04d'o8qd'*g| EjCXkt(Y׮aYJ)TZS ~ijOԜ1%U]]=ɗRL6%uMb0!o27FcM#K\= Tmj;;_HGb/4#/vD&_I KKJNb= ƴ9f6zdI8vF%:2C$% Pcb1ׅVƎ͚ABXp z.h8Gv3$o%";Z11jO>nfi qSk]'(Vڃ#_Ϟc}/\NUIVwS-Bl89Em(:ә]Ƴ9Em)&M2 %NT&6W@ t^ĥ~: .R:q^Ʋ؆G{EVE*3޶LK|V`BLHÑwWQەY~ $wA/iCi55x&6x8FZ+gW%9eYp{ ae?]Jۑ,̒@W GPAf@9qw WGtx.l7rJf[Y0.&0w!bR#m쮃>*+OfDM W,EykWg>?pc=#d z F9%URrvͪ_ ܒMH{PhSHc{bJϜ/}FLǕ2GLK70_ed/P (u1v G`};eD(Y~wysm2fB)l ,1%vcm{S$ܜ=P0O,WO^fIYFhDtϋ@"ca'ͷ錁9PE/BN4hj1 _YHFu(LRssi0=7@wʌ&pJ]͉1 ܦxJ!XS͟_WYY_xM>rtzk$wIES}8;z~FMh/ puf$M=6pf]D-[iIXS*9.ȀY@pY, ~e|ḋCرIǾ"›/@]OrLvz1{0" G{`A22jPmM|e̒^ՁtZ> G?A_6V_ !@~~QM<S[ tTDQ.XOOb>tIS).\e0KD9߭l 7́<:6'҄5q`߯Z :Cc./Sԙ; cA(.Sh!\@ywU޽a'ѧ:~ i[)}Q5]JVs/Q`ՒֽK ҆t@ƪ^9d4k$e"zRйA(GNRi|x#Wb.Tg4[$}΁#Ê"Ç]a2`oQN Ny2Rpiֿoq*)|/_]'a2bh.,@{†sG"T躧$}C,~Esrk7fl ;+ct-?hGd/!+)}> 8drLħl?dy-&H_ml:oyzKDܦyK\c f;Gk~5'3(xIPΐyq+Hπ8zUnɇ=\I3(,.2/e)MW@UP1 3ŌB$K!K88cxÙC7ƢeB )|fӧ=ɯ6LHB_!b8LJSi #sX0?&6E=1*9 q}Ul/vHfUl%XQn,|FL0tz}7`/{FT:wCtB]h jRp?gc&}NκN$ց-YIEȜPrÿwg%Y+QV|g D< E¥!u3Y,:MRv࿔ui|C>C1Ctggpsȷ$ ]oέ.pnv:^6SRk`ZpoT=ԉ{amj85Aɡ&yL  fNtrSCT~ѾUd[DFMf8B~owp[g$+x8e^V\6m&+t1doRAjzsaƜOr49G0Y6'DxQjt&r."醈]d~ʛd VAl gN5ŶUHSF^yގc8 oNҭ[iZyh=7BXpN'hFǕp\kZ9 lYasٴ%vuRŮXQӀE{5+PvYE~>͵ڎ8 ÿQ N}*ϺM]R8g|)ȗ %9aLVyE6jddpthZpsje%Me ^s1"qnL+aD ,*W'@:ib"fZ_<=wfkF3)Q9˫9brcBdّ+7GT = _9$' gʥ<ڥLɽ?B^|3b%Q D(rrצ0P sƦ%ktk0dրpq--Ok>pүxį!L6|g ڒZ#,&l |Z,~8h:N %(aN>G#@w̧1IDT&U?-9E2 j]Srɛ*J|W|7|"lp}Xf6D0*>i&3U,z!|"|7ۭlI]Pz^:Bl@%|qXC(%Cb8W,MJ)|*|p/&&gڲ:L gnjDv$M>]Q=^tǜ9SzZS Uǵ%gRb/9|NE{,b6ٗ>j/ NL2 #b0D$?|µ+A|ކ\9Wߎ7&\4kFW5D|syd?&F|/THxZ7;}/VR 'N]ySkk5o~QNn%DStR%>2x3VŅ$jC-(/T{لy򛢎u(P#صն]^||U)EPdg,l}y3]!%h7Bmތ g&sp/f͌ zYܠ{6r(gUvߏ:V㪚biHjW=|FVW q|El4RX$y&iRa8 e?{|{|y||CgG~|[Dgk@UR 8l|OU ʗ+|a8JY|H,$^m4UeifJ >"j4|Rf؅z!X]B&6Kaê$g jj1=._gu-W ] u |fy^!AS}fLJ&C~qLUlzBAe|'6&wZ$`|?r?n rw6 d1qF4e3#kP3uH@{jVjЪJ3s sE oFT l}?K6a0|ޮ^6./#d"oN$|;B*v*$%9DkHnoBkr^xUK:w-YY&܃v}ǖ7H:zLV<- id/{.Ak1yzzэ>%;S`K}RSL|٤7:+:ʡr&N|pIr'/\9 QBސ z!GhS&zl~"LMD~F?vWjMi*ޗ"Xׅωi# =[2cnjR%I=0mqw!iM[WIgMbh¿ɎETl|2>ܫ67LMHxo*r|f۫`_p/ N7}j6|cXwψm.b|vZz|a=V S;`$Bh63 . _*$ Yp0& |m}dk]|y3 A"_Yx]~[GZVPg~e|_|9,Gp%YMvfc&|o\|w7s2naB Ib>|.kYxAPuh$IjCU> q}MVL?e9P&-ԅu{]WKQg Euv8Ddy[3jZ|s0YFgiXl*}_[0g#h9J2:܃p.7?ηvg--LJ4_ `Y֥`joe6J/1}m*| L"0~lݨS ^H.l+W޲0M.|Zn!:!b0оR}:Ě,X%YoeّSFT4|6,8`8n  Ҫ0k}!T{qhWrugGt|oH+Ru|:AqГh)xN(!KRkSw|3ken :Y>0e&<9z|{=o{|?&G~|tʉq|;NܑoՆK۝Pۧ/((*'#vlRPqPZl<Ѿ̍|xj3c,6Ż@8(Ad4q=_ju[2DCxw0e_wF6UVc(j!ƕ|=,p.b8oIK :e;@%"P!r|Gz׺)5Ɠ|%+9[d5f0kRbƖ׵@zGT_2|@X7x?~cy:I۰Uq>y||l(8n:*|#š^tĕa99(R _.WIeQhXkJ" _6taJN"ρ`qA$p`k염rفe|8/:/W7}bxLKW7M_%nh;W%v75C5mtmƋLT cDvé#mEs> j|tn.| ¡m,<%1g|$|H_Z!P9~l8ܤɛ>z]Ř),?|}y97̷yYI!TNx |o &V_~鈌%s|%Y|d6:|t"w>]2Kq^IzȞC*|ѳjQ$; z24J "L( @tɽ=w|ph+*$ڤƙoǮoŃ#E']z$22|^'3a斴ܳm[3\qGScLC"Qxrd~@`?S ?C˜0Ac~U] '+B^38}Jv;CeY*p{? j|㦉reRH$Wf A+x 0 $?rhQP9ߗ1cZ||dw?Iw)fYޤzє:9Xd5@o*=E)Z*Qz XPS |{k;S_mAz8rfz]5&?4B ꘺ȑ}yQa/PU(vI(ZF)^뎄l:&<ڒiGR R>LD&+RbؔbhlBl+䡪E7YHbȼQꎣ,~\VNȂZbf EaFQcJ@fi?A 6ZGJ4g&Mz24g&SyLL?6g&1E79(ltS&=OhnoU%XHXoU%TaNwtAZ{9ϐa]%+c)+z6[0Y{k;=%,uj1Wn1fz!_)CMj!Zԩ`N$/^M ݫJRll ٵa;>qzȠ-\7ꓴݪ(qh }OӁKzЁ~N?{Ul&3DӨSRn$頿 %9׆_nt@\Tk{b6tŰ=UvRF9>1Tb2j+Pl"c㺔lb rlqߗH}~VBE׼9 p@?Xį @Z=ѣ9,ca]UdEjz #_8s;\bd[ѫCm!0;7"6Xh$!ՌC-$l*x&sJ\xBN6|e C >k±dh|1$XFWI#s{rJ2Bk:(+p6yJ2!͖}Wdp=Ӷȁ&aYCl佌ܝDł\:t33HQP1-jcoHԵmSWJ*{Ily X,cXЛbeJ]cǖ"ղB=@fPQ7(` T9tFrɘҗ1վ+tdW+al#eb@3N`+1nu*vH.)N|M]:9I B>/4,*"6X$$s]X oė ³5faVĀqO(rgn't观[ymyь G/…Bظ3{us7mG<攖/ c`/6mh|j&_eLJR60+ ʄ{A4zl3uՆ$㽨k/8ʵ+QKh7*g}Dv[dVj1xg*,.1)t&k}}C1i'^)sOu*%;*`u\.8\Dl~׾I|`)TUK)80j|?F|95 t<̳\N!#٢SyJ9pժ&^nSbIwm'E^J)bN+'RuVE;6-N2LLw.>rŸӸ#]gdHr&. P`<ᚶv=@9|:Cġs`K3E+zQ@O4DoiFfi@\h0Һlf }R6*UXS*wXytc!Hƅ TǤwDtr@K6-~`/Kt9)4x1PIcJ6:Bv5\3=šKMWx@2 r=%GC [ߜe^V(Y" /S&³6P)J*[R*ŸXRc 'YdJUMxA-AINS3O8KOLPS\+4\ҩіP"Qmrz0X.#L !z: P:MWT &K437Me^~%mv*ZU ,dnIǼ sC$,W.TuVhα%Zs폚R^ 4 cbWZ \Q\TD^玶8M= g[53ał3S%&ERlD5AF 5HgɽRsD)i  $ Re+W`=*{8Q_ 'sfaLwy/h.`Thbe/Q,To*M`ӭ\s.);9n'8;yӔ\IP6s!hMy-Β/~`~3O:V$ ֘_Ѯt#vvW.J cB:umLhF"W{D^gZD@ʯ*{3*c;verwz#?ŦyPJ @;X_ϫH9/KZ6`i%nQвD 31 DsW;1"e'V2O:(]3wծ+ n`nsILև臯H5KBÇKQ.{M ?y* ԏ s@+Bܻz;IFT-nB>`:Mk' !ΓZhd7Y}Da'@>x?c6N-4t,HX.Ro‡5U~'ݙ+^ IYgnPu,#ЎX,M]g@@! l^Ra~氳n?j!q*~ԋVy'sZ,u#-AlCN{e3mjqh4s+3<3X+'B:D93e{ӮUKpnE g.pTʲŞf}4!KKd^%Tyy5Ic?:5謣0LG(XdjOD,t(3 ~6o\w 7yl:;IŶrFٮ%KpCU-4ŲIzgr;9mV2ۅ`˕'-h+6yXE xG}R™,q GE AFx ^s$$|:#iBjeyQZx+"XΦJ j)K ٩qVd߿[ixؘ'IT!"8)S78VES'(?nΒk*'e;v fk됻UOj{eJH՜ln 弨x1FGZ,n>r!r]0]Ǘ'{5߾"&0oU O ،[b [`e1E}9A$KOy8eXU/[=j8Cò>-q .Qq2&Zkf`):yiG PR}&u)&BbaeDVw٢'_/,ǭ)fqB\".oi mIEn nӶa΋ٻl8i(-(4toO|&d%$䢃/Zϔckm~ӓ|r ĕ A$䂈2;mBʡ9 = km7-A2`OL|X ECP@,Pk Ly80GNٻ<-uO9ل:LrJnJMU C(zQeL4^(.φN5 \KX4l?BDPl(Y2Q|CM;[&C7*AeޱY•NÕw.}i1ts̔Q۰Z.e>N 178ȏ^{KVO+Ll>B$/'e`@HLDy! G>ܡ(5L v>\"_WyNp`NA& z*xk_B$v.)}`|;~J^v_%ixbQnIDhs(lxrTg}I 3t:Ы6/Klrk\,_2Fׁ ~ca_Ḹ]r!0De󏩫mG I{@0(aǚB_ \cID9öʛN=FykǮ{'Y!;[d1,MF0I/"%3S0PHV C`V$:}V21Ld۬v?~9lP]W(d+~&9V{,^;JR#zq>ɵӁ|:4嵬TIhk@,R`k8D\9VFQ@ =I~"i]gS*򠲥Reυ}(s.iR?@>(U̍~<IUbU^ L-xjyR}MtOψD38/*|{F|FBVi`-~'ZI,-uXynY0(HiHE*֔|2Z4 ;,lbr 8jܱCkB3a.o$\?u0\cf($>=79Əw7vS84/wʛԢhES `"9}(3o MsK b)NT`tm!4 iͲ2#^/ahP<ʇ%<8MΎ<6 yRU0 hO/0N*s|1\ #vW@&(ݔ޻=|x;6a\*T ;LQLC{1AZ@ P` =h1aX`q?IMKX`EyyԺ46-\oP: ڍ.-;Gj[ua$/g_!8V]N$dor xiQV8GQ; X 3^%ַZSw<%{rA&AG4(q)7^G9ᇖ;T*YzX͛){5ﾞ6`CzG:uCwr@;>ox6RQO_U}~N7 ~,}0(^F0?NYj.g@aq!%ig-Ф™GX%jcau zz)gKCPHc;(1;л QAFGpQ"Y ~.f.u#]Λ?@s6έ8"򍧖*M1dT W.f k^2?dMd Ӷl62Tx$mvmN+T4xX@![~J}7Kk!N7CzށW ,nQ&A\8|7̰v 1)&>Ca޿o:`/!+^q0݅@'c {QP4`kRuC\k ㊲ iDCkpvE?i~Y]{f/l=T@+AzVo`ڥƦS :?(#YdCsL)Ap:Vt[׀aUQ^"(g@q)$]u< 'x^jbQ@uBw.Ru6{~sH?k bec k? Ր%,!zWg2B]%S(E?َ5D`0cUXq7;ñt~=5ϯEb^?v#fjq[AD^XKh2V=2+M=BۅUtkD\%dѱҜ`wSng6t~eT^,ʀx CF%A~ΆPˎOj(4W} 4=slP+}OB4?/8PL@*p{0N~+G]Mb P\r&͙}ƔBBqռu9jkg6q1\f&@UѶ~fSl aQ+s4}jv\tՔ# 2>a޴(h:(>.cFǾTunt? l79Caֺ*73qm\yvq9SCL^svߛ_5*r"1 P#һ0g#x_r΅uk?ؘD};݂BBԲgh$0ېUbPYފXp=ȉ~e壉0C:K Xs:(foYUBZQ60Zf,KU(o.;=;g8͆%( i.,M>bp5DH[q tDvvC>G6 usli_$!N嵈$>%]޺qHE9edW:/߫3|17~(E/RVz4c,8.}(͵" Pk{{svǫrO[{p^]slw4b^JÎ`ٕ{kw|١쒢6.|-oϹО@llB{cn,~-=?~$zxX5ǐh)߃cVu9rϬw*tYbbUS|`c rQ rR4&KQjfΜ[ʭךt IwybAGiB`Pr ۼ_Aģ~*0[ UWjѪ_u21Qx^!HM/ٮ9Ů~AK4(ЃQ`yٜ7Z-;! s.E҆+=ӻ< -hjӦaZ6"9X8<owF^UujGv1s7?$Փ| b9>TnPɟ;9d1"dLP491txv(ƤR@rUu)+2O%`̹fn,%x.!{HwTpytm.e%)vXRUDn"v9уgs?a.T{W=6$}JѠeGTšwﾋ/0pzEdK wiW_uSr,Ҿ%.=8 iiψ"%>Jcb^t2ڝ7ѵ`ƑX콥Tl՛3QW bw2:,ZyEIn#T5#0;Um.X:2n;iMŔ}l^Be{ШAQ diJ:L X.fj7\UqçwA#8Gt*=Ғ}|.rm6LFS)fm}/jN "&"1xZg+m-ǥ pV_d WwM4bSD֍"Xxā9>nm/˴A2w>?EHo rI8G!Gs3C׊-=7}XE(O68>`Zdw@_ `#5ֶ+Fdgx(_ǩ tT$ӥ" SR%ϊCCbGHJ/%vs'݇|'cΐjv;SC̞IͶv0捴wR/Z5/D7\6G V OE%)ͽͧMwͳݜ= Ap6-$wP*v86(5 ߣLӸ?vRV)o]˹206v#RӞ.34*kyU-fp zK^D`2ܑ]g 6@Z[VTMQt&v0>npp,@"ȝ3PAF8Ќ/~4, Qy{'{]Ґ86U'jOmM:VM:lT-K߇®vRnp # >XLPtyI_p9#[;O&=oDS!T;\*R#asp~K84+kQ@Nu5h`N5Shn"Q} PU|\Tg<'39tcb́Ysp0xAlf"V>ق-)ҤAGǀ8YkP/E__;CO{w>pK»Ԛﱂpn2E]韸Y+BP+mՠ&܍8ܿmtc{޽o q=ҥ\DG.?  ShԾe}.q?8:@"`/0V9.*CzI_D !V~ĸ:]Gj % m?M=ː᭎|f#eҁ8QRxnIUu\qo<.ט H7[.~@thr#6,qo"}kx.t&Pb>>bKRvOi|ȳ JV*-7N+YwCb!Šx?sh#!O,,<,/{ ~=ƛ?R``US?NAh*t=&e#DXPG+AFZzE&s5c2UUؤt EQ'h.\hayAeŷɵ貁gՊ:9Or㟂d`bu[liD}2-NEuZ†)SKa3r0)B5Lv-O)꟨m)s!ICD lR'~ {hc'U6"9ا}FT~9-bd+u+߆xpSJ]\:XZ1JxFu'Fue9'*;Ϭ4+jMbf*=;P^?,O ! lbD)2CDCąHWiPwm?t-7 v0.ѼuO:FWmuŹ3s#$h.3_Uyq^ẻWyy8i,9ë#i!jVVUheָ$B<E^?GT]z}]ƦCh(ͳNXH^hyAct+! ;B;ke%z&Ӎ{Iq)#;.i%WQ\GTOzV-r%9۲N0mRY5"$.Ǜ\+z[d& r̯t]T* "qEAuYVe(HI2"F%`c)6[v'Bخ`L18MM,P۸`ǃK\-.`/nF+l0ҍaz _/Io)?o1Z`niwơnMO7tu{bZ@aYg(^c;*Λn~dAxn&JA2*޹QP6:6"v:nb} *tI,< <6]8tcZ$T˅XٿIǑoA&7! B_9FJ㒔NnmRlvE*FU,t}92fjCuQ3Vbs xhGc1u̠_UMLߢ'Fe"ҳg[z$2_M: fƌ,!1.'d%*Ey>@ErćtsRGy ,=1@Q^9b޺0]zC#̻̍;]"l"׉Y+y_a.< [; 3w4/.R+珉YX!GCR)pJڟ-{,c $XBF@A&Z4 ɴ)ς%>pp1  <'Ż]A S,+RV"DuVZ-Mao 78k-Es,HpmXN*lQ[ ~oNYdRrtq!~6vp` A-~B$(kRD2hL5)Y@N|ӱCr$MD NJMOh$S>n˽Z챤,7ǼT-l_<)GIk&Inέ2^-1PކVz}>΁_՜ sH3V r`hό[ʐX( Gxm ha]RMԳۏ: pP=R6vxC>*\3ki84=H5ޮ^3PDcWpH:T1{u@>m͒C7[a ܪMe#_Tf6'u3'2*=7@R홖T( +;ҍF8đߵ ^ɯl~WRaG?PrpuE5w6z=EƏ} `w u<a*1PeMl{P/Eq%=UlOW@Q$2bpxExIg/_ ysE~gnI:r`0B[ͤKC ]JIPs>4"si%. 9RZb*{wty8?[{#bv5ߊjKF\|aekkRpr}abBڮMbJ&U`i¬+.1RM lR#q)"au5~7U_XO~18}飶YD%tʘ |3d2) A\ ,9| }PA"77vp5N|"zD|CL7tڔ pyyDT5íХ'zTku免沏tLƑ]Jx@A ۳>J= !E9kbxd;" w 'ଢ9ߑӸ涩%rJjb59W#AKZ.uLٍ:z|3\ݾK!~2SD[%O atJW~YzdOM]ʅ;KҒaM=SȌHreb۠Xp<:c婧EiaZGMҤeBrC߄5v`I}W5#K:?+zN@4t%ccK#ZƐ{"0GQDњχgc&l3[=Džɛ3 ]ᆋ$7؆(Qžoq7'znjYUBŁ*IgzP*7yNUr_d\a..uY4xTG, \=nJ /lXET),QE~i0ٜFyEp&u̓{]<G ^@݁_u64Ey4D3p &:i1p0x A̢@)}#Dk5){TVWO.BoD`I菽8+15k xHh3J4 Q~]oO?.̐$$h6UdeS\%٪K_O}\x֏pӘRͿ߆ZRLi+~v~qTs j75u6dBT/dDnT4ULbX -Nҁ^=!>d9H#Rz G}֐B 6'#u*79q1%Udu.Hfm6Llz1z<Jcۖnxv676l76XkCIm/awz?}i-&L]XZTbw?cVSi7]^i}w}&!"y#=_T* MKrֲt?RDq1&L#$\o:O>.=O7`|P ŹOk5j3GX+Z <%O7AdIFm\ ֟}FVG bթ~S GG+ЉO4nxTM,J?%t7;B-/,l7"{eLSPz#qM0v=#1ߊ@`Uu,0=nS{tPof<"Bt=2r+oa+;Xv-?_9՜vS .u?FhXRn[12RaS@`[aOOᕺ۳%ZH2#Z]?(y?ML+bJLW4wԫ-_`J NYrxUN@G q 7NK ]%FP6 7E;H"Ƴ\{ەy5I_\Gx-K>R 4n=5b5446Qy4+3EEwQ!G"I-C8F8ٺZ` V1x𳇕-BLF"JWʴt+0b9o'Ӳˠ8Y3G)JtMj[t˛bPSsaӲQuҷЫ3R#P|.4V^u9o#M:yq?@ e^0'{1Oz htX FP[&ꌨ#bȊb5!rq \߀ "E6ex Fٸe$Α E'Ey5GgOeoVT 9H[k#9 hng5bC~^d;2$ J=LoxՃ4@Oөj_DG!_ iOS9ELܮ'"qjEq~#7TH^~Gg("BO:Y"&FHL'kc2"aD`?l'da@Gtz _Q VgKt !NlW*)xޫ)iVLã6y4)T!٬':dDͨi?ez6ݩ vsǍ?;jxwu9_dјp4i7Kۗ]Oh=O菲Bg?js>x --Bli'pHrex nbЗu|9R>eìx*`8_YBvhGQMVnC֝Jʃ0WX/7Oc6l8_rHor@%rX5Rzr= 0ӭ:،@Ce e?ML4I˻hfdl S&C 3j vVd[24e2ք χ/#?ݡݝPKE˛u*8u ,ؕ:+XS5`4ڠ1obb,.H_}2cނ--y6aM Lrئ\CZ|"Dע< ^8!D?QA1++҅@L*,hoi~K ' LMlMVc#[;?xS[~!nv\-/C#ׇU x-Dw"!<'g'ևǗ UEvW1>85{63[h~r'@wgAT4>3꒒;p 6,v'H5#Ag{ "]}ro)9m#&&}r:-rTlu6,wLh1|N "="s&zjXGJQ3K#~(~^Inܻ~ B- cݥL2b =s-)ԙ0u]9d V4nOgHWL#h¯~JN>ՓU&nh3x i-T_4;y@St9}jN0^f ^"U4~UZN\XL%',VH\/8=ͤʕs.٨c$Q 9𥙴?3b ڤ>QdBwoZkLpߦ1HN5GX!=EVd#^kd蝼3kb{IX-8ѿUD&}1 ٝK;V}X50R( 60wDڍ&iRQQi8%"fJ$9Eo]kyD7[$.Q!zO)`K"̬lݑCSIC9,vKaH\=k{bs7'3Wu4e&`*-1"U(j3a?/TfGdЃJuk We )TDmnsJ(0"ubvOGaaܬT+6 ;Vt?՟#/ERxG*Ŷ SՑꚉϜN'y3rODqOۇk?|W8e\Yw#\2nz[}6 K97$Sv /ILkP3+ob} ׍X1j{jC|'wzjt>%|pb9._)>~ITe mM/`2e RT g}UqQ_TwKurR=j }s?&TP!Ӄj|0zzoQ P;3C+sS`hÈ${u007]8F=%#wL2zmJQ͛l03`ўZ[II_3MR戮}f1-yvz`ue-ob4%ӦVBbz1O7&`I\bżx?I%ZGp+t>L1|bQ!b`]=D~@/evi DVL' s>f a+ZdP;r@R ~}q3%7I9 1{3^\NJNߑdN峎GL3z3mC )¦CY?td>wUcVVL#-z3Ii3ZlBxª&XpC1.8a?XVkc&Gl$BD ӸOXk;wGCѨ=v4ٖ%{ MIX͓O?btBP3ް+Vq b- ƨE9gBK17IB7렠+T"o OOF)H'%>)Xf5`YsEiS!`Kk5$'SQlf?>C=m~/@".XӒ 1hB>Dй/f ;0] =,7是l݌LS% Ε!{U6,!~ ؼt'T:]>-upb9^Sܼ؇N4|kFfe#& v"J˦ |~$ʯI`XEe:cː%|[;$9(@wȒ7m҇.עndf1n:ÍmOsRkŘo/V4V+ )#op~F^.… qH+gNf\\j*rJHK#7|ߗmY}uIsM 9[(rAHNc\8%њa Md@Jp"93crO<Ƞ¢6=yϯG6 w1M f$@Mi"~Ou?[zMBr4Թ9hYn6$=g⭤ %ya\X٧YAs!u{n0FIiw =BjJnUAT֕'jF&emBD,/t`;aŤƕ T9 PA`I'$5 P!Ocd?`G _CgҒ>s'o=Hzԏ& Xػħ귒8k}iP^tH"R(2~lKu n/e2m·Ҳe#M7׼u$.q"17h~ 3Sg~o%xܺMمĽ5QYiHj>8)ת)=IsHyJLo*5wH53IC#]09PCY -FϽ?5*꩓#(hF3( A ~\%W k8P9:(4pfo cE~$,gv4TcSUKAVŬM |N^Z8y(@RGXp[{GBvsQP$$qݤ(E}1+V˂.g qe%mu2߫Y2LmC)«B3+>ܵrS'o\C*r:!h(n%[&+,IdcpvKHwLoIȂo3KFQ˗*B1UQj%bQAv GR zz-G\fJѮ9 zr[ƴ y0M^dbjQpS7Z(: wF‹=;0|hD\C"z%2MC1I-j-Be;[rr_ iG.RU*91`LE 1 \EKK~ \SYǦv8Dp~Z]IR9 /|.m]/;4⃚kjSO8(ת7S " 2R1O+M~ JySYmx+;  XV}@696N $?jvP)40j{Dͭ6|2s #v4Vf9W5jebނq>6Y:F>\]P23Lԝa~@;{ѿs}d0wroW4d"8\%,GCBW>qL-nm`EfAw 8} O(S> 7FJ|05,Sau'j-AGLQ jU:M qCLx`fwis'Eqg}OKFv}rJ*l ~*UET-ޞ /ؘ5pgCG]p0iW*"7&X?Dt&}',@Ca5(ڢ@yuާV9JJ9ao2CM\5' EA4i#vq#tMBbLlNkSC Zr{CO%v#^@mɱw/]<"];5,b`IiQGh*#B gKƯ?aXH [ =6%v~,*L? p3 tDuZa/%+kF "Cx/YD1Yj:7%!U>3cZ:C ɔ]Yş<60z0~sOg1F0׮THtw.捕E~Vɍ$בmN,Pi3h62ӹ9^Q7}߹N,up>E ClXwv"5#|a 2r*V6JK)`k4 H:Q֩<`#KV*Yk ^gZ4 w vĐm*iX!f-]0BET; Ձ@`<>%ls(nuhٞkb^o2DgGL叆=/,NE&@eZPqhmBJvq7E n?xTMR7Ko͐?zAo}Y? I9,>Ύcd۸1DV )^Fh"NL8%z39}g9p,6Rr q=5qm'&Ku(ά&J2mgU. W ( ĹpqnX}6!IY'/ 9s "RHWGq⫹𙙛xBZxQ֝:ă5XyК.v˨P;؝mh6uHRWV]^\=hDz[+U|$,"Ѽ(zZ0 yv9a|Aaf6M*y])މ.݆2$tr;Fcai7|n*>c<>KFYQ~a.qvX-G#u_JV;*h#maY}+}OZ-[|Şn C}>O4d0)91b'9bAۊCٓz~5=<Cϛa_u3Gz76z@\*ܲ 9XpP LPws1} g!)bB'7{[^P)t<ڃId9&:lz S62hwzT.9J^{Z3doQ3E53( 6lᰀ8,Rp3" [u{ i4d5}7ș1 W0}B"MZj=ȧ;ϞL,I&~ҧ} ^/ITbp2P[+f'?8n byd&)"kbڤE(jn Ό8KL6shOV/ (]ل1KJzcZ]=bU}H ;}d3#q!O2j0ACU*33RQxsCI-#Y^UKU!u4ʠ<]4j&53}WO88ѫuhY$nfiiWT ;p1Y > >̝ɕေ\u@|-$;<`*m&<4g#ٝ~cPKR5,8D:N6ɰW!p:҆WK;>x-o[_E88Ԏ!2`ph3Ca}HPjΦYAoקWVn' ۠y\Bwz]΁՜?(\N^a(?UbMIAחٳI+/hUdxP. t%PR aWF;1aca^  ?YߒDV:9mo&{X-߸@ /e+^n^!ų>LYOw%N}SST0 'z)!Um ̜}x` Sg|4} k2D!o$];6: r_㈾\iDVдwd'A!7OPv/.2wzOT0:^ )8ery E,_::ֶ3=eg9m4 ( )ޑNzj&K[;v9[b[/(?Cbh܏p Xd3% u/Tj,ԤX( K 5Q/1Z,7BW͉FKW~ Hλ&A!2y- hئn\߭{< ,w #aT8crzcLFzu*`;htЙ6J-*ss?sEڷfZOTtee>c]_Qdvf^n^ 1l$ SmŘwTiҸ@ 1%nsE+?t&>ȐJ4TШu`[ۊQFMpƝ }kCۊW Mf7dHUr#izy~i[O!!F^vcgD9T TfpIx ;pJg}^'m^ϲ5>}\# `QoǬ0QPr隓Qt=Rs!6 /A2)|cB Ȉ!H̴_9_~SJ8>P6&96v>\fo $%nK{>X}w zڊ&\lm"F㸃ɲ Q}4u$ 7 =귢?('NjR^f\DU TSzN3򜶫 bbIbzlq~{SNؒX-hAYC+p,V*R1M~+M (WML2; &,923]a[tksrtU>OM)i`ПהI-4/{E'fMS5 5"lfBOJ% TԂ9df\׿ꗞ)j tpsj -NwHs7JiB(18hHzYeA[I5ToaԴΜÂ7mD(w C>l͛X!Ikm$+Yr?a3NU.9/nAP#œjO;pAYQ`whm>B$DlkOjK$G_U|S(peOO\Nٳ⇢oP@ϫȈK\V6 gmVPkvR4Oc? K%J]6\GU2L*Cq,1{~4e+ܗ=ߋ5k]-c |Xs% F1""Gu(QRd(aUC8M018X Vlzyw?VVP ]$eb'?g.1|e#?ߑp+?St$t܍TYd'yMlІNd S347b#S]-6}b6em=Ndͭڣ<^gB"F̀l("Ƕvq09 ՜ĺ6jypieYO꣚$r9g㤂9gU˙ӄ*}-$́w L\ I1ow'݉OV/-FS^`^TT_ςĔ_5) <2èdv6Pɟ@iEs@UJ``漣^tv oI7Z8>>T&Wp(q@QIݐB^>lj=LO'.!M|eUEJÀ٩3o.')qyNnKf箍#VKd A-%t2I5u9M0y7m?V>$7K`"{5ʳ@E2\zh W(aM8eS}]&̸t{v}?@| jinNkږLq%l `]?n7EF1-eD^Px`IPҭcݛ6}Pp(hz+tk?}jK<N=iT#T ڪ#Ⴅ Ѳud䣥> A<673^XVI3I¾yc`2¶\}죕(-Z8L?lHB*"p+5 h8}:#WJٺδAhŠ=Y%[_3hC3`Lx!lvuOݵ_ϵ a?g\XfɤG룈-mrƒ }ZX|`-)ކA3+ Bl$;P(4̿K̂4҇Q=lХD!w4BJJ._ESQ$2 hn[Ag57QO0YIήįӻ"yY^a>/}Ll)ec;@ v;J"WCR=^w{}pnKC#۠<3L!">$넊7ԮY?d瀒D0f` ~?ٿ8bry% eVTvyiqݙ"fFŜ%=nnKZ XϢ9&TX׾ΡͭƏ qad3w[ Q_@-˔:/:%1Weъ!+ Y5pETq]UZ[/P8(H̵Ux.fydCIN_ P5 mٖOA"u9*౒h=T0?x;jԤ-jfaкY./ѝͤyVfGݽi?&8'^3qɽ[˦r=S% 5_KDm28:ZC2b(OkFVjJc:|&oqJ!fˉ(ZGLh b}|8K8Ѯp͞@QT O!Ey9 hgqE]ᰔuB{=J& a?vIߎ: fF^CǨnkwuhL-MoRG\G#숚5_@L?X_E;ȑ 9 qے^ C~VAdqB*BrNy-[UPX/^SCj88lү5ߩVGʧ?N]m{E/3ǭRXފNБ<Ǯq`ÅFl%buo8|H$ WfF>XϟV 9ⴃX=nƕHcm4_*H ć(T $",m*ݞiiB!Q4EwLn 8MƌYIi'N)i4 08a$7zC3UU"\sYa w`i,.B)v.[ ?رωYGbe 1%5(Vun .lZhR55o[\Yn+4A~dʕw,)VELWcSg. ^oFX$Jʠrs"~0&]8sSɻ-1sCOE6e7ӗj}P"Ӡ )pIIZ "5,G͌A8PhCz0޼uszI˜-qia\ӏtҬ3#3T; @c *4=4<p+ڧ9`%6iWg˂ZҺʬv t^ ~-E^GJ|~ 5-<YתPFӷ)|.R֢' ):&w3w)TE4ʍx_; ;Wl k@To^58Af<>Btb m?<>pH S $H>A|"  Y$k3jg6v~Yrt)ɻXff/|h :%UZVB`V!ϳBPĚR(/0]d}/67͊{*ݦPQn +Bp}#Io ԑ'SL~k}\W䏒\Ҕ^1d!9ҽ ]c-Lx~(v?O oUahԟdcz/G}SZ4 [$,^3pJ!yэ牵ᑢxFn Mр%5 Ɏ 2ϴBػrI18cgp@ny#!ݝ>* `z&;᝕ lEq (ĽGы{kyZ'~|upJzV/DFe! Ja2{3Y2)n *pG:(p.`+?Ք‹ѷ9֌$@H2sHM/?ʍ/[7Dy,@8u,:)Od=(5bC轌5Z /^k}O_!&QlO99j$;] kꩬ=P? j#(BISc lVZؒWm'aP#0ϭRul6oB*%\<ˢ^ SVUF X|:5îm1F";qnxanQ€`߹DO8h B=O$/0b]P ^zLI^.亜r5>MP~ <7ܔUlĚn 97GDqTw3' 0EF ͚ޕ QoKY"`JI[+((M/>0B !DJO"~F|/6܃XYDb g@ :,U?AIXo [V 0aۼr*2!*aGT2ѷrEJH*!VS2tB[rP ^N4sS5GTb(}kDYg~܈[Lf1GoE4f6A(^"\}πY^KPo7qIu.PX1ћJ<@j^RT^;6 6fhC⏌O@>9m#mtGD9=$  Ai5mPs2#e^1̄A6S.B,MǗt0QߟvD5"̧DBn&̸Wڀ'/E4N)ؓ4/UY?hzz2__A6 DGв"hý/UqXɊzh[?. N/ vʩd5'ۈC|LO^Po$-Ht= 1a3 3tQ=w#PšI=>aI(>k߭{<2셜"-Cg{6c;cFV&~R^XL:U7˥ÂRqb O~\f#q.>؂o_Gdsg.4kx}J 6>cQ]87ʳ! ϶ ȄiV4~5~C-sqrS:ZIߠ,skP?4a驙?ٗ G eR&72/(qbԓn(6Z%zB:ԎsU-L+Bx C?*V⭤ LmXl!KpwJ?u1lv>!uV<& o$t4'=-, v1G'~{k2Q+5iNsa*-fX:Cφ=:Ce+]U lJ9zH`BZ㡪56M5ָFwӯj{j.qe1mON?~c~WzB̺sK5wUsc_?"i][MվuA<9z'3vr ^(,c04q <U 5c3]<6/^Te[ttEP=/6Z\rb >N28x)ܥU0C~Zr6#} P?rQiP>W>/NE'cb*ῴE ۄ~rconߒ?rbFWJĬx1, y@hW)xe`֚[Խ{4$4C_հKr̍ǁLoPӓfz lYq-0"(% nmiM?u`wqXq=HQW ,TA-D\´Jł֒pgܽh]<('_-#t7Ic* X4Vk!^N'9HSC)NLEWI&{~s@xҒ#[k =fMEN+yfY?Z-ͳ=1HP-x 05Ny2vv0hy7Wc6^I,UZݚV Ht ltsWn00_g]W6K=aGWܣqW%6c y5-!1Kdi@JP$M qu5HqV٫wG%Wd\c2oP\zQ*eEf5aK_'Dʞe=3LjeTPMIMea@Ӈ7(B&oͼN^lA猨Lkή|]BmҠNa4N4Fw!5 Y*Ust}2ΆyIAUA]NcGW"UhD &Cߝ'wP 937?Vg˾#5H,t:l[` 裮'y?l DumPQf w$J`lhr\UWZin|@f.x[8 *sz#:L㚋CRpݺ`< o~5"fh*BFIė٥}^ZwBLAOȬt*g { sT@RϠݝ6Cx1\(h6bcPų> 8GJb\7 ̷=3ɐi(nWWH_^TŔj'=*<L+;S~ 9pz%\} (IQ~ִI݄|<VSl(5ںg\t\^bx;fС} S~"j%=CiN!jP|oĠYfs&'J6l5 ޑ/ɑ o#OOӦ:X0=&O:3:;h%& qW/NSA7^̉r7 _xa}׳se -mr\_6RHKZ ]#U+}=?WSF16A?q^ICr!!CwaWB%nݱs c묊9sfWV-y$v7qsb&4C1G~O!ŐǸy)R S30]j4&X [\YB E˲>615Oʲu<_6^,%wAtG0鎌&¸Iuxy ]qCb" _T0-*aCw?;T ˱&߰+V[i]PFKߍr4٣@.ê(.sĵ~H:"{Ѻ toE;t!5;] iOI/"!C}vM_Ec cH9@<}zw&FIuBT#p( I$B&8cK|_L|\d- |"}6$D72L=JynC %ZA5N1L&U +<ͣ<c&̙vYP%jH8G'eZE@nsj6e(T~K|Cj F&O:)hLаR6BNzP\KWŐYiZ"DxD?D9,5b6Op{Dޗ3r)EJe^k_l#>s5Ac,ܹS{>.F"M| 'e0+^$\toqi9S@g _կ8tuv^ƸwG X~y=R$lqԙhg^fe 0BuKv}P.ff/=߄hc|=,9O+Cjv1fÌ_XsWOktڣz0YҍHȍJҔ"yg^X^OC ?(Xg\kp TS_J񂇧 2Ѩ#G?4dDt`wMd ܻ'Li>$A2"[0_v"$ږ wfD DcmI`ByiJ!dIXjf#(*I 2)ٍtPn /r 3&b/EF{܅y6#MɄ@zC1q_qmO߆F=|-T9a0cуH[¬6iB(+}-1smB# R_o3J37KLġPrv`C9!q]}P)a|w&Yvm w!e3ӊhQR7/ĊRhh#^kZ pҨ`,78q2t* Ocn.kYR9InS)EԌC1A|AधM vV,raÙ|6-ψd+p $oM ًWRsN̦afA]tÌj ՄPYO1~5 fE3 vU퍩:O qDI7 8za(-=&ixIs4jW@&+ᶯ\X8xnX<펇MML?^ʇK蠴J˛qBmh1n-`j3hMzc",zK^ }iF?1m 7tr@~Dް ? MKk!8,I,vJ|{6zHi jmSReN^8P&iCw "Yk_Rvب}\8CIٸfeН"ˆ?Fw'S $ MNƐP$ 7v xL He+߅yf&E|KV[|W W԰˜U~XRer85>ֆlw{eqpb,%'hBK JΛ5҅+qڀW}8}SSDJ"gDf)3_$+_WV!k@WYݾL!1GKyTshHA, &&4Ι󺈥A-nigFq-Ȩ*&Hbz˶1X^y/v*b2iH0HоT/$ۏa=RhHEC0Ԏ뭎66{fڎ S!(ǺByh+w+%byf}q.zXԛ*YLgHQ]dw +_( g$6zaK% s2 Q(pNT5X/Eƿ4u"k?#Tr7x ᦐ [U'۸>S>̓N}NRw: qoD d|U#~afp?0E{BvN]zCcxaw r᪂2 V{ކڶ1=c #@|FrU~`aV'wVDѩNPbnbN9iKzԯi]G|J# ircgYHՌMm3<&b蠇 Z@D2NZ =80qDRK^=˭<}skmTJBl⵩e, Uut]  nb5ءO˷Z'SW[Qnb#_[wWkK?9H0u!g`];bfݔO,q㋜օ%q'r{*s6O縛ڶɢ/V̜D}(nu_?Ǚ'!e%V-ׯ 2Ƀ@a[< c0Y_>V;HާJ~`]Ӎ+;1ǶFr X1K@*זf*>KBr}RyO_ 𸘞`LqirnVB`)B=!J]]6g16z#׀y[:1#yg!`ع+4k.XWN>3Mԇ>p\ 6 $6mar#摲7]ǬM0"'n]B (5Y 5v/$)ԈI?YL 2Dư`*!:n7jܒ(埒l%|wwF|յY i;Ujd1BNb$szLRAZqхsBE&+Q9 *R3VOTP#u(9ʅyRg@_ FqIMF5-ЖY&͐Q(5(j+9™d/B/6#OnDmgT ꌎ2.(]ȅclWq~Œ V2C{IhX+FM٭W9,+%We@y:'?p g<޸%_%{$ CYnI_Qi%0Og5x4E余q|7zM |,8mf^t^մpmzx!ÚRc^V`oeAz8+<:T+[zY?e"9.[_hA$:,ǯCwG)ԆN L<mtj[0| 0ߺKIFIg tXigƔL{K2P2ma@1gXU9R(vˣm 1YJ`I:Q+2^al) YkŞmr%j!G2PAXa]}R)0}$(#!_68M1q}RuX /CA7dO@P͖{dGo%MI#b`nIRԧ~xs-R`)n@ߣՃ]ð`dbs8OH1{h3_8&*\Ҳ d1Ino ,n$!i0(>=U1{T 0*>G8.RH"!lA͖m]gdO9e׬y* hnp] f{mNLњ/9/31ǕAv6dLn+A-&0R#H)3:ydg;Gu`g=ɔsⓒu>,jsjEӆVd8Y 'jqŁsč4 #0uk3|l 3d8$%_NQ ,A2$ԉ@mLXbN`J:E^2 /}2Q!A1iɟupXltĺnЪIpp !^8W+" kYN9TBA,SW*אPq%50nI.H˕׳_os L e1l'S,}-!>bC4%sM-큺I遠69>Ь73KɎ(h rS3w' #3áo{>hbLtfjJճ7f= O| #A1)a8f4c@jj. (_.-x4O)/x[_„fAXI2:Aoe%踊Rz0L1q~фޔҺoWٔ5Z1 OW!-*zv\YMyzjY`Z0t;%՟FJb0akdkP8YBXI?!k&0pb)S&3Q &ɯ=ELdZU6"t7:͐'f'2·c+rFO `Ɍx1^ p7OLf-"ΐ?g5L)98 JvO05j ;\}B҇5HfyaEJqЊ+lV!U6m~e8_-k1 F@$w^$N!|.'#W7 '_Ou+nKtn1fg IYNVw;hD͠翲8tQE),ÉE".8IwP9z𒼾pOFW F㭹Eb1dCCE>np١GCFpXto@+ ]ƲyJ"}7Y>8촎_!ɗ/GZ$op'>Z {V%?v #0;eoNc,aNjW%5T#w^'v8O)NXip?T9I-pBS\H밢>#)NjG2 :6eDfNRHyWZL`/&QoO;zI-$;?=z&^TFLIyNA/zQ\?{p) p32DR1mTrf}FyKO6';DW󫸥H珋,:_;p謟=W~ʼ4J< CԚtAFZ ?hJ"tt V1 5Enw3ulے~d%2Qs24(%9j[Op9?ZM!.kF(verCaW@ap&s~[-//|H=_#gmy6U70KߌяPaACTys9ŇgJ7Z ~8T4d<( 8`Ѧa.Z}lݜ0Yx:bYjvHɡ;b$Nb", 6~V%kV L҃LiS xaꡲʯNY.M1{窥cGlҺmG 2 ,<4X,?DMy7Z53zMVmPcG}Y s-EӀu Tz"ۄ? 7bg9էk  m0Tkԇٶ5[_ûLm'gc᝺Jh타%@PvBOM$ŗnj"$ug0 Îz%Y^p>] !ܡ)X|JTZLb?^JduÂyzF4#dB0q#^8Xy-Ƭɠ*5MibѺ|$jqcd @^ ]meW,TDnh؏皗iQSM_q/sku(E2U .7We!|wɕ OM-3 Wā(G=%=Ϫqd q3ҴLo0uR27vH(eA(y$32CW!wA7Xͷ>X!tAr.@M[/LiQt_5(р5`Ҏ{/r4yRǶ񿈒$x]B@YF [UPwԓbpxЯ*ЍB6J 7LKpK?m^?m8ɪ"ʧQx,@zJ)W֡) s`O4I pUel<ͮ&B20|Q^ֳWr` u '‘=+ /HچDWu` c&J‡%&;(@*꺱a8m3pzjP@VUiܑ9_CI6L)S(v%h$P'hí)eg*zV9[ݎlٛM+6? .طN"%G=IJ3@9[xn9DbFf" kجܹ#'6~tGa5ߝʅ鈗7E,)< L"FSeWi[*zDɻqnfx`(=Oc X!6u}:tㇰ czo݊Of䇷>fUb¥Qe4F8!@}m8G߅H[2_;bL>30bn lL&j#'7jzlBz%4ˑ ?ؠDIӋ$ jNr۶ywXVYš]9V1n `b]Mglcq02z+iSnm\%H 1A  j^fW@+i'j` ,СP6<s*~ʰo&'><܇;v^mken2:FT6%yrTka "Fi[ u#{K$U$nKꏲpZQ Sz(:?ڠ㽩}d0!J=16gݻ@b2-t#:*y|:iU3k2a7G]o@4M$ j&duNW/Nt%"D }F\By$WRo0|KwXFL/Y/r6lgSy[CD_?-4}:] ~PAǵ J u:C u^i_˞ejz)hfP JBѿғIn}/ pʀE0:q1*m {7G ],ז#j~VZ0#S`,}"w؛F=^[UofrYm.ԄK?[5/I+Y^EJE hH=.4Y%B{'klt.@S4,EH |l*pй!}FJX: 9=7F Qk4Hw,sVYH([OWQ}_wTa/i}{v)$kvE8XCđ RȊȘϽ_l;d/~uJ|aʈ&Hi T |TE*-mOKKX\݌*/g<늉+_d5ȉsLQR1^b,5!P7C`)JD jQga4H9iPٵ ]l8r69Yxz=!mk$!kc* C`r=$?^ƕY @^cI^g.pϺ"DPr!v*$NCૢtjOWcF.(3FGgX teMO¡MԐ/YWg{*FW:F#&6@U y Ж6&pW~;x8l5^eTJ蹎eI Mސb-܍Q5ʬ[wEv--RUlvU/uQ`OG ݂=2`Ϲ$M+`69=Uvƒ=2*[N<ϓzLb'V{\N_> [lQX9$1,(kPcDҫbh+H:kM ,OA5{D_gg:vEe|!wyO ]{DEWw4I-9|ֆxdhtᒫPkM^E5l(CS*&43A鴗tI5HՃʆ/AB8aiCsw(+^LN@pDX,C:0fRYw2$[% lûE ׯ[MtoU,eEn@B\y)VNfD@KCWT@k*|@ཱྀr )CӐ.Odꛐ֫Oqڢz0)ֺD 0|Y9 OJ?BͰG:1oj%$Nmh(gDp?`IqBrz%ڃOǏ}*X{BN zw|A:Y7h#-9 z3= ~6}M_ph›P{9e3c,W)pe":❐e)dS(Vo 25Gs헝Ny0Ug/hHIRPKS}J7 H0EkdȬx[''V*|Z̒[^/(O*-e%$}3UobYDB&V jQhFBV9 BzB T?ʗHB2d4>A#76y)R&b{d)ߘ~bqV.A dtlOvU),r'~ Pݭ0x_ 8.6z}÷TK4Չˢf 9QD1h$Iny1#O)q-tHL\%0S, sf4켰f;T\8.`CYR $SQ rSRB/58Cފh5"GYPJ׾"q a?0&8()]ucR+72LK m`f½h=f]du;g҃~-l)Τxل ^ Γ=Ymctb[nw+3~ x XqUvY D56.i(f|)Ѱ"w FX*Yg㠗E2CV7V_N9TN]&|U~>"{M -GmENS*e׈L퀑0T4W ^P`ĸky)'uqb`aA(쏢ۯtstkֽ&iJui O .xjJ* b)g# qO}8 rr=r(dAi@0[+cTtXߣ.rۡf1wfQ(^GhնՁ"ue*?o.nڗ|//:lH@7J7.Q*Q: P*gos8Ms"  ;P DZ0",Ӿk)?cO^EC[|O$:6_4K E V/ O6MᬨRgL+E&UC*Țc>  P_)>zh/6 %1h݇ 'b10^$csⅽ*U{`DFc T;D%('OK5ؔAAX/*[dI>d1ߘ Љ;1)J3N˸SρD|Zv'tkd"1hNxƒHK"΋_kI׎xLk;fou;=tpw%-7arJO-M3 _NIS΁janT/64 E*i);Ajͫa&#,7]lG'^q\x/w}d˦ "̋n'(7̵xJqYS%S<~G&r#]K*WHqlߖ)S<cx¿,"]2ř>5]$љ`S|wD$ W!}Fz:L5_#p ;3(YsVl}vg/ʠFGs-A2m q-è[*CՃ.8U '0p4sD2 Ԝ!b8[ѱKT) >ފ΀N6w,e-R̐Q}3y d!]yQl$iQ80lMWvv*p}PPϮepBi?%`x̎4iN:1E +jo`7 >oF-Hzj4 Fs7{RU6BDR1ϖ d0N-#?v*IT;,X^Igw[z+PiwwMY$^aic5Zcvif[F@&yvSu{h]qV ̩3Rzk .嶢* hj*O]o$A?_Ja%XX)Y }C$ 7MRֿDd>{Vߪʷf +JuΗb8c"?8E71(G"y &rOκ=tĹWh2 &lrv`>L_S L>kU:oψ„Vgȳ 6)LmDe"DȊ}O@2YhrbrS0I{%YjM^H+%Q[.&Fr#͈+HC/եe>ӑPyd- 2^(dPm-sDbY<6%Qhzݩ/6`oS4~Nd yaP>KObt`k3V9giQ'6iϸIJd z)oqdfprTMrPj.P0S< yX<闗,ke>eÍsyye=wi2v]A 2GS 6* INUhz?x'IE~--u5m^NjOF}xoBP97rENP>%S!DLdL|i5ڇU+9mĚaeFa2&g>PU1"$ӰUs]7IFWT;.XK 1U>d0Ch,Xoǫ2?aV öSCF +J} )7ʓcqtM_>t:2 cv%Tᬼפ"_h)tU,r[&(V^qƔFq8K7siTxxb%thakx4 F~ns"WTg7&AZ& :d@wpR$h(wd; 3u,2D[0H, ceC.ǥ8$&;N!z."YUݵaq=2IԋOrw 8ȵ[eK ďJlV1yAlWEUM6# ̏5B{rUhOMTIeV,k_("8M 0a;ރVǡY}_kˑ1>4ۙ1iĦ65j,3wRkF"tf[ǨGn- 3DOh*Mhx!dުw (yG<(|2ew̖,Gco$]p扒H"R !Ϣ8G43:V)4FVq5.2%>}=i8gsYbi !Ei7p )?/5r=in텕ň8RBy]t"Pc*^*#@ŻTh ɚUZh`m_a42D9|¹vl&kS:s/YcGYnxL31ϲ 6t`cH f F%,ٻ005zxHpΰgx("]g>Ys 3²atU!*F^>TIa7l U'Z7g#x* QEo;70*.! uuE ղndGDBFH%"%rhG/QUfO#<1 볤vId8:%r3R=QZ;ڗF=Eq*!, KL UѸS -7MWQ"">/7 58WB*S_n >FQk2Oߐsa,b;ȝՆ(tpyIX|<4k V*0zc)BI3gYbtPp{)xq}]T= ~ WbD78LN^Xl-e"(3 >>qЊ/z1N!΅5EQ7hD*ֺ儊ntv4˳nA)&.{r^bJfIec a齄q@qfW身Z:=6ysa@Γr{}Sxm6q53g8/ 9$_ WW7H&XCo$3! & Ys9q l?+NOq&] >SpaiD@ #BΦM&xyHqɡo&A]V֝j]}Kx@ '4V$jQYR+/Vپ  ù߯~$Ӗ.¤wHwsJ n.FBM[BݓyiWի{]bԈ~f-?Z:Vq xzىn*PQ^zVS, V+r=7>rx(0z#WzK (VCUu~Jy9\T Cա .B߆{6p;[:? 'P!9+%9o'\h aO!Ofctz^  1d+WwNSMr>lUof4 Mj¥qndRcX DP.<$F>ژT#, Qh;ςF.'P e2i0æ}%_ jh,s e|B,Ն@߬IWpAx)qC#Yw$u3+,ru(֐[o owemV M8CFN? YTH_"~wddQNH"MRAG+I+i'N(Z(xoZ8&sݡ .$K{jŻ""8X^pȾtF!?Vb?KPa!k̥a7JQ -+&JRBmEȗ DP萅VD?j臖x9UcOFYcC3-(_c?5΅I)7t񋆾 _ !iyd9r8K^S]pm Ć1#x{Z#"b9an k$ 2akAG¡r L,teǎ(i{!VVNŸi?t ބ8ޒ26TID"pIv E/ PKBJ_CExfǵuJ=Em>vÞu/ދj+!=Utυ^Z!&߶O[R5/N<;pP Y3O`fvg|}urX K@yޚ+gYWi"(&9eW1!'lgxAo>&f\wD<PP"EKpFKu'1?2МD1VwP7]X-)RY$ඛ`\5}ш7HT:Mjn*S/ Wb[-Z}:(;.j]JkjbOSn̙^L]UJ*DXO6 m=`=< Hte566/"=ۅ٠MNxR77Y#QsO %ժ0Oaˋ-±>(51x Ri:r}n(%2eTr6oWoF {.H+Lؿ ` X2ڑ@2PO17O֨EʡPkPQx'w6CNmWMRS>7TAo/]s觡->{P xo%\{*PGKE4 $`^GYk8`/RNR*BGlIls3ϖOΉ|7nEghkaT-&Z,0_FUݴy {X?Wc*~ |bw޹RQ2|$ϡqLQ)a (0ωZ+ߚ2b.|>cևz>Ӳ+8J@KXڲmC %R[RDqJ^溄C)+)"#NѫCKsL#"Gg7g|+jߏPi4iRi'„3 ks[qexՏEH+db~YmB:{۟Iسt HdʞL M{ϑjTV[p{*:ãAD^-zd[$@R%l*zie1E Y x:HYl-p:[_;&DH"(EY-ɒX1 P(! q%H@8Qsj YY% KUi< !Lײ4Gdr+++Ʋ`s΍to5 m I{uIk~TqwY~FM{>E~X|'J& P8/dBmL7̴7yRBBD8*ƠI Mk FoTZ%>dFoBS^M223_>5c-!uΌ_,RQ$nUu%~ QqEܥ=x_݆f+Q&@| ߟ a-l!z2w>wMKP=l]uˀ?δYtb IBW%dthK鄟R SF`c|C(ؑH̀Q Cx=d r 1yl/&-* j@aur,UԤEvoX5 p5xo ̐Ɓ+ b$Hd> z6 |OSQ^ DN-hi]i]L,Pק[I8+n!(7&{C ۲tb€rRGSk*-kBxsR+t.aE~^ J8yzJpĺ3 x *,e݋L xJN/p!fi[ ZqE[nPe^/7dHL3t1+7 +a2,\%p5 d 6GD錪eyJ]4XRe|N"{*\v\0Vu<\/׬ҵ[0 /# VAZeL9@ͿBiI;=LJD~@(? CW|&qf%(yo}Op6MU΁sV=GYZ ^ND9@/ObX,"-Vz@ق[k&ex6,OO@%._9⿼'&_fwbmD%MlHn\ D8ٔxNws0H@?R0kgb_E0 -(꼅>(VMƒ)reW:lKPkYl-} H<Q 9Ğ_ZaRT_GkVhy@ `[9U{dc{ wx~ye΀Gl:C2H!r~oHIM* sVdWZQ%oBRvp-.n!9sj̓0׿YB)F#Ղ7)z\ʴQh_]ZcǘZ\RТTpoӌ#uE+v$!y*NS׻m)hSYP Ħ!^m#C;2{D)>n^0g= n0yY>gWtԛ>S 鴃zTFg_*˄ԜPꋶ _~J`{<$x@롮a ǥTue_qw>7\cE| T] 毪( wK}FfXo]I.uD>u1 9VV"6ﻖR4soA 8@avKvlXxMZM⮉˪4R'A}M+z>DnFCXomg$Ӭ)uذ@J*Q,ɍNv^r ՞;s[P [2ãcҲbq),Rۗ&4H7E !^"Ih!lI~S V 5}1ʹePݍP^B f9Ł,jHB1D*xc%.2=r5Lb J DZ+͛X*ę?H{K/wWyn2'!yt˨ѧi,! m3^c 0u}bZ'h=m\u}@Lu@+{uEkl[26׿l@WxKV)]zA6yZ;|#RY #ΑQTGؙnÅ, LNg ]ڴ@u𘝠)F7J{DC—R=3)ߧ;49g&`+ 14+'8PVJ7*:(@@tB]A$[q ^nu4}-W&"I%˃[E3n`Rfh*TM; ͵n?}ZoB=`*z~g'zuJV#Hj!U{qvи_Y -9m֓&_:ý /qpg1ŒݤI~]TZf L=Mx MhQJc-R"\(`SB:/1Ӫ Gp~U= uB"4xD4:~cqxg./˅Qs W~|t̎" Y(l*ͦ{.9{7Xgj^d[UЗvC N,zXi#C@ە;,š?=ahPG NITZ:Y_V5X('IJ} IS$‘fs I=}/Q[ A?Fa5[O\\^\*i\T8/b+c"$''EB`~^ >~홌0%ڟNQvaKu#MES@EuwW56WS벡).nó{*TtD9I!NƜ!Cp (&Rˀd]J0GXEAxvTu[ޞ(o6WDٗN^ՄQZA;P DU9IW*wAg!.ڳes;OS"!wQ"_|e܍kU'fX4(} RM@Z mۗLZO|P\ 7ze:a_H#"҃ՕM r!L,  [ cZ Ik TiV脩pJH<$?2zȜ" G^ޠ\l5^IWdL9TƋWJM|.dRTSKؓya3C,Y4Usb*ט8I敽HNt^q)3VR hqbƕ^H ,~+6'!F1 b-.sj~_`moFRQB}oOL搓 Q%pP0L Ex:Ga+Na)ygcM]IK%#UwD x֓vpr`6]uWS\Q,%;Pg#oc#̊cyH5 Z9.Q*o~1q`B۩'2٪*7x!x䈔ozQ)QXE}o}Q0 Jh$ #W2p<b}z,B>ur*#`9j>|ƜZM0KH&h.8ysjP5GX&#+YI޽Mz"~x[+BQ3V܂DLU S_? u5+ZaCI.CogMl( %uC^euC(͙5ŰZF[p7w-P"63ʝnFR> ҲhzO9_]6!@w#8*zW~@~+k*tBii+񶠩6^-f-a ~՗sY;ϛKXҽ乘F^nH.'$'z0IwS4,6ϓW¬nޛM?F #' EU*MW/F~gxEX#c2} k)) Ch_\fd0U 2FlO$(C04Y)/nL NeP/-AXIKmbwT[\YDӑ,@GPk!˿U.q_AT 0ٺԁ#d>Qϯ495oEOӫ(APSY `Pi96qP.<u$3͐f&ih 硓Il+Yb((qO^I-?Ed͚(Fj7?#9܄E:tu Cl> qm&@I.. pR!G$Ia.B3b0\ټܓ4W%hmzSߵ|ػ+;_!Qa qbMVLp{ܹ<7k/.{rFQbv!H}隟, &gT 2諐I٧]HFp6ʎ-T  -X٨T$ͣaq+n:"!2=.BJpE!_PsĒfEHv$ mᖖI؉2%/վB }Cl__xU3N;›P*db8h*ѷxlM_to{2^5y[1VipNƼ0(5gho78T%_@Wt/ʱ%xS\^`c$&{-Ihq{6^R/cz$"w Rb4\!_ ?H\G7mRw:UT5Hue;Z9笠*+dEv{DF{\trs*UBinI\qim/m z< ^:Zr-%D@08EUph]w/Te]ؐ>PL)[# ExO-;VرVqbiB12+;tgd 4NrC{rP GPZc eo?+#frI S&qtX${?ʯeB;Wx6%Y/T2xyTcqdIy-.gCŐ3Fw/W/8|1n)p|T{\o>;W8VY1X ጙ*"e+y/ھ*=nV{Uu=}džb3JhBrl*]a>[PLOO-HƮPʝxōH?-_t{0"oL-JS_~mb Hps]s]'4Ob<,fuAsf-%tH ĺ:z!CAۘ2 b&cBf,(bcXqx?=g!y9$ĭJ2'S@ҵNKNjt|\Wr+o2e@>̿x7{؋jVIgAPd`Z+2Cc~6-Tx ݃^7QH_3؟FP]+}GbP號0waXD;|-d!m ֙p Uc>z^F$fnz*ܠ5#GdL.!5_3-Ƒ{B2"[I eYc BE}Q+讶dA)Si1[K>HaNBW+k&/vS+-d`v49O8Ubt54b VH 8TjNq :@-`~r-MRS>HrԉG@q/=7!sEnkD YgXnwb;]/~#*ػl,j)$nv{Qbjc&&dlG\S?H߼7O|qAk/հ>KZ8j]-g'U4`w_LX g!߆vhH_-R]H <>߇^ɖeV a$O}y-zTD-]=)7+p9u GLI[#6ܻ̆))|[]|UBHs6FI5%QÔMH¥ #1;-FPⓞ~dXNLbgMr!\.pzÝQjD 3H$off55Ĭ?ݤAM(*>sWrd?+ij!'\Ѭ~{B#40B\'{Ãz\ {`["Q++J!Pb/G}2cʗ ܏bMeCJPtIIKޖp:UxҬA\`)Gx+ړ&`l!Ja,{K~\.pej߾pEY^d+.}Tc:j2;9j)‰`` Y=5񵩖/ Nv~n5EZw:o̳g|^sAR J!*# YZ